(data stored in ACNUC30630 zone)

EMBL: CP002049.PE125

CP002049.PE125       Location/Qualifiers
FT   CDS_pept        143678..144670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: csa:Csal_1453 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: Q1QXK2
FT                   Uncharacterized protein UPF0065; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13268"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXE4"
FT                   /protein_id="ADI13268.1"
FT                   /translation="MRALGPFARFQIFVFTLAVFGLGLAQGFTPRNPTCIAPADPGGGW
FT                   DFTCRNIATLLSDIGAVRGRLRTQNMPGAGGGVAYAHVVGQQSGNDNLIVAASTATTTR
FT                   IAQGQFSGFDEDDVRWVAALGADYGVIAVSPDSPYDDLTELMEALRAEPASLSIVGASA
FT                   VGGWDHLKVLLVAQAAGLENLSALRYVSFSSGGQAIVELLGGRAEVFSGDVSEALPQIE
FT                   AGNLKVLGILAEERADGLLAEVPTAAEQGYDVVGANWRGFYMPAGTSDEAYTFWVEAFR
FT                   ELEASEAYATVRQQSGLSPFWRGGEEMTAFVYDEVETIRELSEQINLTE"
     atgcgcgctc ttggtccctt tgcacgtttt cagatcttcg ttttcacctt agcggtgttt        60
     ggcttggggt tagcgcaagg ctttacgcca cgtaatccca cttgtatcgc accagcggac       120
     ccgggcggcg gctgggattt tacctgccgc aacatcgcta cgctcctctc ggacatcgga       180
     gctgtgcgtg gccgcctaag aacgcagaac atgccagggg cagggggtgg cgtcgcctac       240
     gctcacgtcg tcggtcagca gagcggtaac gacaacctca tcgtggccgc ctcgaccgcc       300
     acaaccacgc gcatcgccca ggggcagttt tcaggtttcg atgaggatga cgtgcgctgg       360
     gtcgccgctc taggtgcgga ttacggcgtc atcgccgtgt cgcccgacag cccctatgat       420
     gacctcacgg agctcatgga ggcgctgcga gccgagccgg cgagcctcag catcgtcggt       480
     gcctcggccg tcgggggctg ggaccacctc aaggtgttgc tcgtggcgca ggcggcgggt       540
     ctagagaacc tgagcgctct gcgttacgtg tcgttctcga gcggtggtca ggccatcgtc       600
     gagcttttgg gggggcgcgc cgaggtgttt tccggcgacg tctccgaagc gctaccgcag       660
     atcgaagcgg gcaacctcaa ggttctcggc atcctcgccg aagagcgcgc cgacgggctc       720
     ctcgccgagg tgccaaccgc ggccgaacag ggttacgacg tcgttggggc gaactggcgc       780
     ggcttttaca tgcccgctgg aacgagtgac gaggcttata ccttctgggt cgaagcgttt       840
     agggagctcg aagcgtccga agcctacgcg accgtgcgcc agcagagtgg gctctccccc       900
     ttctggcgcg gcggcgaaga gatgacagcg ttcgtctacg acgaggtcga gaccatccgc       960
     gaactttccg agcagatcaa cctcaccgag tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page