(data stored in ACNUC30630 zone)

EMBL: CP002049.PE135

CP002049.PE135       Location/Qualifiers
FT   CDS_pept        157409..157915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3476 anti-sigma-factor antagonist;
FT                   SPTR: A5UYY1 Anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13278"
FT                   /db_xref="GOA:D7CXF4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF4"
FT                   /protein_id="ADI13278.1"
FT                   /translation="MNRQLRRANERSDKRREREQERRKEARRAARVVPAPRKNAATPEA
FT                   APKTRPAPGTLRQGLSLAYLVLVVGILLAQAFVPQRTDPFSLFVHALFYVIFGYFLALQ
FT                   LFRRGVARAGPVTVVAGLLLAALVEAAKLLTGAGAPEAVLVALALPGLLLGAWLGGFVH
FT                   RQEGR"
     gtgaataggc aactccgcag agccaacgaa cgctccgaca agcgccgcga gcgcgagcag        60
     gagcgccgca aagaggcgcg ccgcgccgcg cgggtcgtcc ccgccccccg caaaaacgcc       120
     gccacgccgg aagcggcgcc caaaacccgc cccgcccccg gcaccctccg ccaagggctc       180
     agcctggcgt acctggtgct ggtcgtcggc atcctcctgg cgcaagcctt cgtgccgcag       240
     cggaccgacc ccttttcgct ctttgtccac gcgctctttt acgtgatctt cggctacttc       300
     ctcgccctgc agctcttccg gcgcggtgtc gcgcgcgcgg ggcccgtgac ggtcgtcgcg       360
     gggctgctgc tcgcagcgct cgtcgaggcg gcgaagctct taacgggcgc gggggcgccc       420
     gaagcggttc tcgtcgccct cgcgctgcca gggctgctgc tcggcgcgtg gttgggcggg       480
     ttcgtccacc gtcaggaggg ccgttag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page