(data stored in ACNUC30630 zone)

EMBL: CP002049.PE137

CP002049.PE137       Location/Qualifiers
FT   CDS_pept        159755..160504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0138"
FT                   /product="cyclase/dehydrase"
FT                   /note="COGs: COG5637 integral membrane protein; InterPro
FT                   IPR005031; KEGG: dra:DR_2377 hypothetical protein; PFAM:
FT                   cyclase/dehydrase; SPTR: Q9RRV8 Putative uncharacterized
FT                   protein; PFAM: Polyketide cyclase / dehydrase and lipid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13280"
FT                   /db_xref="GOA:D7CXF6"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF6"
FT                   /protein_id="ADI13280.1"
FT                   /translation="MCSPLETSTYQRGLHVSYEDYKRTYGQDYGQTYGQSYGQSYGQYG
FT                   SYNRYDDDDGDTNWTYVVTGTLFIAAGAYLIYKGLSSDDEDHTYTYDTRSEKQSRGKGV
FT                   QVRESIVVNKPVSELYAYWRKLENLPRIMSHLESVTEMGTRSHWKAKGPLGMSPEWDAT
FT                   ITDERKDETISWRSLEGSEVPNEGTVRFIKRGDSSTEILVSLTYHPPLGPVGAAVAKLF
FT                   GEEPSQQIRDDLQNFKQSVESGSLSLV"
     gtgtgcagcc cgctggagac ctcgacctac caaagggggt tacacgtgag ctacgaagac        60
     tacaaacgca cctatgggca agactacggc caaacctacg gccagagcta cgggcagagc       120
     tatggccagt acggctcgta caaccgctac gacgacgacg acggcgacac caactggacg       180
     tacgtcgtta ccggcacgct ctttatcgcc gcgggcgcct acctcatcta taaagggctc       240
     agcagcgacg acgaggacca cacctacacg tatgacaccc gctccgaaaa gcagagccgc       300
     ggcaagggtg tccaggtgcg cgagagcatc gtggtcaaca aaccggtgtc ggagctctac       360
     gcctactggc gcaagctcga aaacctgccg cgcatcatga gccacctcga gtcggtgacg       420
     gagatgggga cccgctcgca ctggaaggcc aaaggccccc tggggatgag ccccgagtgg       480
     gacgcgacga tcaccgacga gcgcaaggac gagaccatct cgtggcgctc gctcgaaggc       540
     tccgaggtgc ccaacgaggg gacggtgcgt tttattaagc gcggcgactc gagcacggag       600
     atcctggtgt cgttgaccta ccacccgccg ctcgggccgg tcggggcggc ggtcgccaag       660
     ctcttcggtg aggagccctc gcagcagatc cgcgacgacc tgcaaaactt caagcagagc       720
     gtcgagagcg gttcgctgtc gctggtttaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page