(data stored in ACNUC30630 zone)

EMBL: CP002049.PE139

CP002049.PE139       Location/Qualifiers
FT   CDS_pept        complement(163723..164412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0140"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG0546 phosphatase; InterPro
FT                   IPR006402:IPR006439:IPR005834:IPR005833; KEGG:
FT                   npu:Npun_F0767 HAD family hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: B4B5M9
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13282"
FT                   /db_xref="GOA:D7CXF8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF8"
FT                   /protein_id="ADI13282.1"
FT                   /translation="MGHPKAVLLDVDGTLVDSNDAHARAYVDALKAYGYDVPFEKVRPL
FT                   IGMGGDKLLPQVIDVESDAPLREEIDARRGEIFKSRYLPDIKPFPGVRELLERLRRDGL
FT                   TLVAASSAKEDEADALLERAGVADLIDARTSSDDAENSKPDPDILQAALERAGVSAQEA
FT                   LLLGDTPYDLQAAAPLGLGVVALRCGGWRDEDLLGALAVYDDPQALLAGYDASPLAPEP
FT                   ASAPGDV"
     atgggacacc ccaaagcggt gctgctcgat gtcgacggca ccctcgtcga cagcaacgac        60
     gcccacgcgc gcgcctacgt cgacgcgctt aaagcctacg ggtacgacgt acccttcgag       120
     aaggttcggc cgcttatcgg gatgggcggc gacaagctct tgccgcaggt gatcgacgtt       180
     gagagcgacg cgccgctacg cgaggagatc gacgcgcgcc gcggcgagat ctttaaaagc       240
     cgttacctgc ccgacatcaa accctttccc ggcgtccgcg aactgctcga gcgcctgcgg       300
     cgagacggcc tgaccctcgt cgcggccagc tcggccaagg aggacgaggc cgacgccctg       360
     ctagagcgcg ccggcgtcgc cgacctcatc gacgcgcgca cctcttcgga cgacgccgaa       420
     aactccaaac ccgacccgga catcctgcaa gcggccctcg agcgcgcggg cgtcagcgcc       480
     caggaggcgc tgcttctagg cgacacgccc tacgacctcc aggcggccgc accgctcggg       540
     ctcggggtcg tcgcgctgcg ctgcggcggc tggcgcgacg aggacctctt gggggcgctc       600
     gccgtctacg acgacccgca ggcgctgctg gcggggtacg acgcgtcgcc gctggcaccg       660
     gagcccgctt cggcgccggg ggacgtgtag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page