(data stored in ACNUC30630 zone)

EMBL: CP002049.PE147

CP002049.PE147       Location/Qualifiers
FT   CDS_pept        172929..173564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011991; KEGG: ddr:Deide_22910
FT                   hypothetical protein; SPTR: C1XNB4 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13290"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG6"
FT                   /protein_id="ADI13290.1"
FT                   /translation="MRWVSGREAAAALTDPRTLRQLEPFLARECSVSQAAKETHTKPNT
FT                   MLARVRRFLALGLLEVAREVPRKGRPVRLYRTVADAFFVPYEATSAESLEAAMRERDAY
FT                   WEELLRANVVRARLEDAPRNGGNWGTRIYRDARGRLQVQAAVTPDENYTLLGPERPAAL
FT                   SSWRDSVYLDFEDAKALQRELFFLLKRYQQKRGAQRYILRVAMAPILE"
     gtgcggtggg tctcggggcg cgaggcggcg gcggcgctca ccgacccgcg cacgctgcgg        60
     cagctcgagc cctttttggc gcgcgagtgc agcgtgtcgc aagcggccaa agagacccac       120
     acaaagccca acaccatgct cgcacgcgtg cggcgctttt tggcgttagg gcttttggag       180
     gtcgcgcgcg aggtgccgcg caaggggcgg ccggtgaggc tctaccgcac ggtcgccgac       240
     gcctttttcg tcccctacga agccaccagc gccgaatcgc tcgaggccgc catgcgcgag       300
     cgcgacgcct actgggagga gctgttgcgc gcaaacgtgg tgcgcgcgcg gctcgaggac       360
     gccccgcgta acggcggcaa ctgggggacg cgtatctacc gcgacgcgcg cggccggttg       420
     caggtgcaag cggcggtgac gccggacgag aactataccc tcttggggcc ggagcgccct       480
     gcggccctct cgtcgtggcg cgactcggtc tacctcgact tcgaggacgc caaggcgctg       540
     cagcgcgagc tgttctttct cctcaagcgc taccagcaaa agcgcggggc gcagcgctac       600
     atcctgcgcg tggcgatggc gcccattttg gagtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page