(data stored in ACNUC30630 zone)

EMBL: CP002049.PE151

CP002049.PE151       Location/Qualifiers
FT   CDS_pept        complement(175971..176240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0735 hypothetical protein; SPTR: Q9KEW4
FT                   BH0735 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13294"
FT                   /db_xref="GOA:D7CXT4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT4"
FT                   /protein_id="ADI13294.1"
FT                   /translation="MDHRDPYVSDAPRGARGGFDVISVGNWLLTLVLLAIPLVNLVALL
FT                   YWAFAGAVHPSKRTFAQAGLILTVISASFYLLLLFTGTAVPLTP"
     atggaccacc gcgaccccta cgtaagcgac gcgcccagag gcgcgcgagg tggctttgac        60
     gtcatctcag tcggcaactg gctgctcacg ttggtgctcc tcgccatccc gctcgtcaac       120
     ctcgtggcgc tgctctactg ggcgttcgcc ggcgccgtcc atccgagcaa acgcaccttc       180
     gcccaagcgg ggctgatcct caccgtgatc agcgcgtcgt tctacctcct gttgctcttt       240
     accggcaccg ccgtgccgct cacgccctag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page