(data stored in ACNUC30630 zone)

EMBL: CP002049.PE157

CP002049.PE157       Location/Qualifiers
FT   CDS_pept        181821..182681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0158"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: rle:RL4415 putative transmembrane component of ABC
FT                   transporter; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Q2CJI8 Oligopeptide
FT                   ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13300"
FT                   /db_xref="GOA:D7CXU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU0"
FT                   /protein_id="ADI13300.1"
FT                   /translation="MFSVFKDLLRYNTEFAIGVVLVGVVVVYAGLSFFSSVDPTLMYTV
FT                   MPDMAPSAEHWFGTNSRGQDMFWQLSFAFRNTLVFGLLVVVLSRIISITVGLVSGYLGG
FT                   ATDRALMFVNDIFVALPIFPILVLFYFTMRSDLNTVNLAFLMACLGWPFDARLIRSVAL
FT                   GLRHREFTRHAVFSGMSARKIMFEEHLPYVMPIIFSTAMANLIWAIGLEVTLAVLGFTN
FT                   INIPTVGTTIYWANNHSALVVGVWWWVVIPVVLIVMLFIGLFLLAVSINEYIDPRSRLR
FT                   RMERA"
     atgttctcgg tttttaaaga tctgctgcgc tacaataccg agtttgcaat cggcgtcgtg        60
     ctggtcgggg tcgtcgtggt ctacgcaggt ttaagctttt tttcgtcggt cgatccgacc       120
     ttgatgtata ccgtcatgcc cgacatggcg ccgtcagctg aacactggtt cggtaccaac       180
     tcgcgtggcc aagacatgtt ctggcagctg agcttcgctt ttcgtaacac gctggtcttt       240
     ggcttgctcg tcgtggttct aagccgcatc atctccatta ccgtcgggct ggtgtcgggt       300
     tacttgggcg gagctactga ccgggcgctc atgttcgtca acgacatctt cgttgcgctc       360
     cccatctttc cgatcctggt gcttttctat ttcaccatgc gctctgatct caacacggtc       420
     aacctagcgt ttctcatggc gtgcctcgga tggccctttg acgctcgttt gatccgttcc       480
     gttgccctgg gtttgaggca ccgtgaattt acgaggcatg ccgtcttttc cgggatgagc       540
     gcgcgaaaaa ttatgttcga agaacacttg ccctacgtta tgcccatcat cttctctacg       600
     gccatggcca acctgatctg ggcgattggg ctcgaggtga ccttggccgt ccttggcttt       660
     accaatatca acatcccgac agtcgggacg accatctact gggcgaataa ccattcggcc       720
     ttggtggtag gggtgtggtg gtgggtcgtc attcccgtcg tgctgatcgt catgttgttt       780
     atcgggctct ttctactcgc cgtgtcgatc aacgaataca tcgacccgcg ttcacgcctg       840
     cgtcggatgg agagagcctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page