(data stored in ACNUC30630 zone)

EMBL: CP002049.PE159

CP002049.PE159       Location/Qualifiers
FT   CDS_pept        183711..184625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: rle:RL4413 putative
FT                   ATP-binding component of ABC transporter; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: Q2CJI6
FT                   Oligopeptide ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13302"
FT                   /db_xref="GOA:D7CXU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU2"
FT                   /protein_id="ADI13302.1"
FT                   /translation="MSTLLDVSHVSKRFSMGGILSRKYTDAVVDVSFSLQADHPEIFTI
FT                   IGESGSGKTTLARMILGLETPSHGTITFAGKSTSEWKRRAARSDFMRRVQPVFQNPFEA
FT                   FNPLKQVDRYLEATARRLLGATERKAVDAAMDEALQKVGLSLKEIKGRFAHELSGGQLQ
FT                   RVAIARALIPNPSLLIADEPVSMVDASLRMSIVNLLKRLRDDLNVSVIYITHDLATAYY
FT                   ISDRIIIMQKGYVVEMGPARAILESPEHAYSQLLKSSVLSIDTAGMGVLEPADRRMTEA
FT                   AWSTMGRGRLEPRPDGRMVRVAA"
     gtgagcacgt tgctcgacgt gtcacacgtc tctaaacggt tttcgatggg gggcatctta        60
     tcgcgcaaat acaccgacgc cgtggtcgac gtgagctttt cgctacaggc cgatcacccc       120
     gagatcttta cgatcatcgg ggagtcgggg tcgggcaaga ccacgctggc ccgcatgatc       180
     ttaggcctcg agacaccttc gcatgggacg atcacgttcg cgggtaagag cacctccgag       240
     tggaagcgcc gagcggcgcg cagcgacttt atgcgccgtg tgcaaccggt tttccagaac       300
     ccatttgaag cgtttaatcc ccttaagcag gtggaccgct acctcgaggc gaccgctcgc       360
     cgccttctgg gggcgaccga gcgcaaggcg gtcgacgcgg ctatggacga ggcgttgcag       420
     aaggtcggct tgagcctcaa ggagatcaag ggtcgctttg cgcacgagct gtcggggggg       480
     cagctgcagc gggtggccat cgctcgggcg ctaattccaa acccgtcgct actcatcgcc       540
     gacgaacccg tttcgatggt ggacgcgtcg ctacggatgt cgatcgtcaa ccttttaaag       600
     cggttacgtg atgacctcaa cgtgtccgtg atctatatca cccacgactt ggccacggct       660
     tactacattt cggaccggat catcatcatg caaaaggggt acgtcgtcga gatgggcccc       720
     gctcgcgcga tcctcgagtc gccggagcac gcgtattcac aactgctcaa gtcttcggtc       780
     ttgtcgatcg acacggcggg gatgggcgtg ctcgagccag ctgaccggag gatgacagaa       840
     gctgcctgga gcacgatggg tcgaggtcgc ctcgaacctc gtcccgatgg ccgtatggtc       900
     agagttgcgg cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page