(data stored in ACNUC30630 zone)

EMBL: CP002049.PE16

CP002049.PE16        Location/Qualifiers
FT   CDS_pept        15524..15817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: KLTH0F15928p; SPTR: C5DJF2 KLTH0F15928p"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13159"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR8"
FT                   /protein_id="ADI13159.1"
FT                   /translation="MADYERELDGDLGGDATPYMSDDDEFERDGTHTILGDENENLARR
FT                   NDLARQLEDLVAAALDWSEISDDEDAREIYEDLVDLYERVSAPLEDTDDEVV"
     gtggcggact acgagaggga gctagatggc gatctgggcg gcgacgcaac cccttacatg        60
     agcgacgacg acgagttcga gcgcgacggg acgcacacca tcttgggcga cgaaaatgag       120
     aacttagcgc gccgcaacga cctcgcgcgg cagctcgagg acctcgtcgc ggcggcgctc       180
     gactggtctg agatcagcga tgacgaggac gcgcgcgaga tctacgagga cctcgtcgac       240
     ctctacgagc gcgtgagcgc gcccctcgaa gataccgacg acgaggtcgt gtag             294
//

If you have problems or comments...

PBIL Back to PBIL home page