(data stored in ACNUC30630 zone)

EMBL: CP002049.PE168

CP002049.PE168       Location/Qualifiers
FT   CDS_pept        193818..194051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr3165 bacteriorhodopsin; SPTR: Q8YSC4
FT                   Bacteriorhodopsin"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13311"
FT                   /db_xref="GOA:D7CXV1"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV1"
FT                   /protein_id="ADI13311.1"
FT                   /translation="MDTQTLLIWLYVGLMAAGMLVFWAMSRSPKGVPALEYMVALLIKK
FT                   GLGGKPTHLWVGCRTQAAQRAAVPELMLDASA"
     atggacacgc aaaccttgct gatctggctc tacgtgggtt tgatggctgc agggatgctc        60
     gttttctggg cgatgagccg ctcgcccaag ggggtaccgg cgctcgaata catggtcgcg       120
     ctccttataa aaaagggtct gggtggaaaa cccacccatt tatgggtggg atgtagaacc       180
     caggccgccc aacgggcggc ggtgccagag cttatgcttg acgcctcagc ataa             234
//

If you have problems or comments...

PBIL Back to PBIL home page