(data stored in ACNUC30630 zone)

EMBL: CP002049.PE170

CP002049.PE170       Location/Qualifiers
FT   CDS_pept        195277..195801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0171"
FT                   /product="rhodopsin"
FT                   /note="COGs: COG5524 Bacteriorhodopsin; InterPro
FT                   IPR001425:IPR018229; KEGG: cyc:PCC7424_3927 rhodopsin;
FT                   PFAM: rhodopsin; SPTR: B7KKH0 Rhodopsin; PFAM:
FT                   Bacteriorhodopsin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13313"
FT                   /db_xref="GOA:D7CXV3"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR018229"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV3"
FT                   /protein_id="ADI13313.1"
FT                   /translation="MWSVNPVWSGAAYMAMAMGQATTEVAGRTVFYGRYIDWVVTTPLL
FT                   LLALALTAMYRGPKSKTLIAGLMATDVIMILSGLAADLSEEPMRWVWFVFGCVSFGVIL
FT                   YMIWWPLYDIAKSRGPRHAASFRNVALFLTVLWFVYPISWYIGPSGIGLVDTTTDWFPL
FT                   YRDAVFLQGRL"
     gtgtggagtg tcaaccccgt ctggtcgggg gcggcgtaca tggcgatggc gatggggcag        60
     gcgaccaccg aggtcgcggg gcgcaccgtc ttctacgggc gctacatcga ctgggtggtc       120
     acgacgccgc tgctgctctt ggcgctcgct ttaacggcga tgtaccgcgg cccaaagagc       180
     aaaacgctga tcgccgggct gatggccacg gacgtcatca tgatcctgag cggcctcgcc       240
     gccgacctct ccgaggagcc catgcggtgg gtgtggttcg tcttcggttg cgtgtcgttc       300
     ggggtgatcc tctacatgat ctggtggccc ctttacgaca tcgctaaaag ccgcggtccg       360
     cgccacgcgg cgagctttcg caacgtcgcg ctctttttga ccgtgctctg gttcgtctac       420
     cccatcagct ggtatatcgg cccgtcgggg atcggtttgg tcgacacgac gaccgactgg       480
     tttcctcttt accgtgacgc cgtttttctc caaggtcgcc tttag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page