(data stored in ACNUC30630 zone)

EMBL: CP002049.PE173

CP002049.PE173       Location/Qualifiers
FT   CDS_pept        198258..198731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0175"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro
FT                   IPR017936:IPR000866:IPR012336:IPR012335; KEGG: ttj:TTHA1300
FT                   bacterioferritin comigratory protein, thiol peroxidase,
FT                   putative; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; SPTR: Q5SIR4
FT                   Bacterioferritin comigratory protein, thiol peroxidase,
FT                   putative; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13316"
FT                   /db_xref="GOA:D7CXV6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXV6"
FT                   /protein_id="ADI13316.1"
FT                   /translation="MAAPQRLRVGDDAPPFALPSNRGEQRLSDYAGQWTVLYFYPKDNT
FT                   PGCTQEACDFRDALPGMGAAVLGVSADDVSSHEGFAAAHNLPFPLLSDPDGAVAKRYGA
FT                   YGTKQLYGKTYEGVLRSTFIISPEGKIAEAMYNVKATGHAERVAKRLEALRSA"
     gtggcagcac cccagcggct gcgcgtcggt gacgacgcgc ccccctttgc gctcccctcg        60
     aacagaggcg agcagcgcct gagcgactac gccggtcagt ggacggtcct ctacttctat       120
     cccaaggaca acacccccgg gtgcacgcag gaggcgtgcg acttccgcga cgcgctgccc       180
     ggcatgggcg cggccgtgtt gggggtttca gccgacgacg tgagctcgca cgagggcttc       240
     gccgcggcgc acaacctccc cttcccgctg ctctccgacc cggacggcgc ggtcgccaag       300
     cgctacggcg cctacggcac caagcagctc tacggcaaga cctacgaggg cgtgttgcgc       360
     tcgaccttta tcatcagtcc cgagggcaag atcgccgagg cgatgtacaa cgtcaaggcc       420
     acggggcacg cggagcgggt cgccaaacgg ctcgaggcgc tccgcagcgc ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page