(data stored in ACNUC30630 zone)

EMBL: CP002049.PE179

CP002049.PE179       Location/Qualifiers
FT   CDS_pept        207887..209410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="COGs: COG1472 Beta-glucosidase-related glycosidase;
FT                   InterPro IPR001764:IPR017853:IPR019800; KEGG: cvi:CV_0259
FT                   glycosy hydrolase family protein; PFAM: glycoside hydrolase
FT                   family 3 domain protein; SPTR: C1XRD5 Beta-glucosidase-like
FT                   glycosyl hydrolase; PFAM: Glycosyl hydrolase family 3 N
FT                   terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13322"
FT                   /db_xref="GOA:D7CXW2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW2"
FT                   /protein_id="ADI13322.1"
FT                   /translation="MTDALLMIDLKQPRLTPDERAFLGERRVGGVCLFARNVEDRVQLG
FT                   ELTAELRALLGPDVLIAVDQEGGAVVRVRDVPYPPSMMALGAADDLGLTRKMGAMSARG
FT                   LRAVGVNVNFAPVADVNHNPRNPVIAERAFGGDPEAVARHVAAFVAGHQEAGVGAVVKH
FT                   FPGHGDTDLDSHLELPHLAADAARLERLELPPFRRAVAAGVAGVMSAHIVLPALDPALP
FT                   ATLSRAVLTGLLRERLGFDGVIFTDALDMRAIAASFAPAEAALRAVAAGADMALYLGPL
FT                   KEHEAILRRLEAGLASGELDPEAVARARARLRALARRFPVAPAPEAAWEVGDEARLEAA
FT                   AFRGTVALGELPKLEPGARVTLVAAAAVAAGGASSAVRAPAEALAAALEGAGVRVTRAF
FT                   YARGAEGASVLGALAGAELVLFASTSRTRMEGAELALARAVARAVRPPQRFVHVALWNP
FT                   YHALDLPGPALLTFGFRGPSARAAARALLEGGAPGRLPVALEVARGPYA"
     gtgaccgacg ctctgctgat gatcgacctt aagcagcccc gcctgacccc ggacgagcgc        60
     gcgtttttgg gcgagcgccg cgtgggcggc gtctgcctct tcgcccgcaa cgtcgaagac       120
     cgcgtgcagc tcggtgaact caccgccgag ctgcgcgcgc tcctcggccc ggacgtgctc       180
     atcgccgtcg accaggaggg gggggcggtg gtgcgcgtgc gcgacgtccc ctacccgccc       240
     agcatgatgg cgctcggcgc ggcggatgac ctagggctca cccgcaagat gggcgcgatg       300
     agcgcgcggg ggttgcgggc ggtgggcgtc aacgtgaact ttgcaccggt agccgacgtg       360
     aaccacaacc cgcgcaaccc ggtgatcgcc gagagggcct tcgggggcga cccggaggcg       420
     gtggcgcggc acgtcgccgc ctttgtcgcg gggcaccagg aggcgggggt gggggcggtc       480
     gtcaagcact tcccggggca cggcgacacc gacctcgact cgcacctcga gctgccgcac       540
     ctcgcggcgg acgcggcgcg cttggagcgg ctcgagctgc ccccctttcg gcgcgcggtt       600
     gcggcgggcg tcgcgggggt gatgagcgcg cacatcgtgc tcccggcgct cgaccccgcg       660
     ctccccgcga cgctctctag agcggtgctg acgggtcttt tgcgcgagcg cctgggcttt       720
     gacggggtca tcttcaccga cgccctcgac atgcgggcga tcgccgcgag cttcgccccc       780
     gccgaggcgg cgctgcgcgc ggtcgccgcg ggcgccgaca tggcgctcta cctgggcccc       840
     ttaaaggagc acgaggcgat cttgcggcgg ctcgaggcgg ggctcgcgag cggcgagctc       900
     gaccccgagg ccgtggcgag ggcccgcgcg cggctgcggg ccctcgcgcg gcgctttcct       960
     gtcgcgccag ccccggaagc ggcctgggag gtgggcgacg aggcgcgtct agaggcggcc      1020
     gcctttcgcg gcaccgtggc gctcggcgag ctccccaagc ttgagcccgg cgcgcgcgtg      1080
     acgctcgtgg cggccgcggc ggtcgccgcc gggggggcga gctccgccgt gcgggctccc      1140
     gccgaggcgt tggcggcggc cctcgagggg gcgggcgtgc gggtcacgcg ggcgttttac      1200
     gcgcgcggcg ccgaaggggc gtccgtgctc ggcgcgctgg cgggggccga gctcgtcctc      1260
     ttcgcctcga cctcgcggac ccgcatggag ggggcggagt tggcgctcgc cagggccgtg      1320
     gcgcgcgccg tgaggccgcc gcagcgcttt gtccacgtcg ccctctggaa cccgtaccac      1380
     gccctcgacc tgcccggccc cgcgctgctc accttcgggt ttcgcggccc ttcggcgcgt      1440
     gcggcggcgc gcgcgctgct tgagggcggg gcgccggggc ggctgcccgt ggcgctcgag      1500
     gtcgcgcgcg gcccgtacgc gtag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page