(data stored in ACNUC30630 zone)

EMBL: CP002049.PE185

CP002049.PE185       Location/Qualifiers
FT   CDS_pept        complement(215049..215453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: geo:Geob_2748 hypothetical protein; SPTR:
FT                   B9M1L5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13328"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW8"
FT                   /protein_id="ADI13328.1"
FT                   /translation="MDTPPDRPPADELELVFVYNADSGLLNALGDALHKLVSPQTYPCS
FT                   LCALTYGGVRMRPQWRRFIAGLGVRTRFLHADELRRAYSDLGVPLPAAFVRRAGTVEPW
FT                   LTKAEIDGCQTLEALEQLILDRLKRLSPAR"
     atggacaccc ctcccgaccg ccccccagcc gacgagctcg agctggtgtt cgtctacaac        60
     gccgacagcg gcctcctcaa cgcgctcggc gacgcgctgc acaagctcgt ctcgccgcag       120
     acctacccct gcagcctctg cgcgctgacc tacgggggcg tgcggatgcg cccgcagtgg       180
     cgccgcttca tcgcggggct cggggtgcga acccgctttt tgcacgccga cgagctgcgg       240
     cgcgcctaca gcgacctcgg cgtgccgctg ccggcggctt tcgtgcggcg tgcggggacc       300
     gtcgagccct ggctcaccaa agcggagatc gatgggtgcc agaccctcga ggcgctcgag       360
     cagctcattc tagaccgcct taaacgcctg agtcccgcgc gctag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page