(data stored in ACNUC30630 zone)

EMBL: CP002049.PE19

CP002049.PE19        Location/Qualifiers
FT   CDS_pept        20445..23219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0019"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG1074 ATP-dependent exoDNAse (exonuclease V)
FT                   beta subunit (contains helicase and exonuclease domains);
FT                   InterPro IPR014016:IPR014017:IPR000212; KEGG: ttj:TTHA0998
FT                   ATP-dependent DNA helicase; PFAM: UvrD/REP helicase; SPTR:
FT                   C1XVZ8 ATP-dependent exonuclease V beta subunit, helicase
FT                   and exonuclease domain-containing; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13162"
FT                   /db_xref="GOA:D7CWS1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS1"
FT                   /protein_id="ADI13162.1"
FT                   /translation="MKLRVASAGTGKTTSLVRRYLELIGAGTPLRRLAGVTFTGVGAAE
FT                   LRTRVRAGVAEVGATGRFLDLAFPPEHRPRFEEAALELSGATLTTIHGFMAAALRLNAP
FT                   LLGLDPDFGALGEWEARALFEEELATLRFLARAPEHALHAPLQRLAGGAEALCTQLFAA
FT                   RALAERFRLAAAASERERDLLALFEAAYARYRTRLGALLLPPPEIERRALELTRHPEAM
FT                   ARLRARYQLLLVDEFQDVNPVQGRFFEALEASGLTLEVVGDPKQAIYGFRHADVEVFRG
FT                   ALRRARARGELAPPLTETRRHAQVVTRFLNHLTRAFAERGWGFSAAEAPEVTCAGPQAA
FT                   ERGRVEIHWVTGEAAMGELRAYEARVLAGRVAALLERYAPREVAVLARSYAGLAQMEGA
FT                   LRALGVPATMLQGRGYFERLEIRDLYHALKVGLDPQGLSLAAWLRGPFAGLSLGDVERV
FT                   VLAEAPLATLERLAPEVSRRLERLREVVRRGPVEALKLLVRAPLIGERRYVDFLEPRAR
FT                   ENVDALLFAVAAHPPPDVGALLENLRRLSRQEDAGDVPQSGDGVSLLTVHRAKGLEWPV
FT                   VALFDLGRFDTPRAAALYVAPGSGEVALEGSGAFAELEAAARARDAEESYRLLYVAASR
FT                   ARDVLLVSGSVKGGRPRGWAAALAALGFGPEARPWARGDFVLQRWPAQRVAPAAAAVAD
FT                   ERALPAAPWTTRRFLEPPQPPLCSPSAAATLGDEGDESCEPLPITDPDEGEPLPGRARA
FT                   VGTLVHYAVSQNWSARSATHLRNLEAQEVMFAFSAAERAEILAEVAELLGRYEALLGAA
FT                   LPALEAREADFAELPFALPFAGTVWQGVIDRLYCAGGRWYLDDYKTDRTVRPESYYRQL
FT                   GLYARAAWAVRGLRPEVRLVYLRAQQVVRVPEEALEGALEALLARAPPDLRSA"
     gtgaagctgc gggtcgcttc ggccgggacc ggcaaaacca cctcgctcgt gcggcgctac        60
     ctcgagctca tcggcgccgg caccccgttg cggcgcctcg cgggggtgac ctttacgggg       120
     gtcggggccg ccgaactgcg cacgcgggtg cgcgccggcg tggcggaggt gggggccacg       180
     gggcgctttc tcgacctcgc cttccccccc gagcaccggc cccgcttcga ggaggcggcg       240
     ctcgagctga gcggggcgac gctcaccacc atccacggct ttatggccgc cgcgctgcgc       300
     ctgaacgccc cgctcctggg gctcgacccg gacttcggtg cgctcggcga gtgggaggcg       360
     cgggcgctct tcgaggagga gctcgccacg ctgcgctttc tcgcccgcgc cccggagcac       420
     gccctgcacg ccccgctgca gcgcctcgcg gggggggcgg aggcgctctg cacgcagctc       480
     ttcgcggcgc gggcgctcgc cgagcgcttt cgcctcgccg cggctgccag cgagcgcgag       540
     cgcgacctcc tcgcgctctt cgaagcggcc tacgcgcgct accggacgcg gctcggggcg       600
     ctgctgttgc ccccccccga gatcgagcgg cgcgccctcg agctgacccg gcacccggag       660
     gcgatggcgc gtctgcgggc gcgctaccag ctgctgctcg tcgacgagtt tcaggacgtc       720
     aaccccgtgc aggggcgctt tttcgaggcg ctcgaggcgt ccgggctcac cctggaggtg       780
     gtcggtgacc ccaagcaggc gatctacggc tttcgccacg ccgacgtcga ggtgtttcgg       840
     ggggcgctgc ggcgcgcgcg cgcgcgcggc gagctggcgc ccccgctcac cgagacccgt       900
     cgccacgcgc aggtcgtaac gcgttttctc aaccacctca cgcgcgcctt tgccgagcgg       960
     ggttggggct tttccgccgc cgaggcgccc gaggtgacct gcgcgggtcc gcaagcggcc      1020
     gagcgggggc gcgtcgagat ccactgggtg acgggggagg ccgccatggg cgagctgcgg      1080
     gcttacgaag cgcgcgtctt agcggggcgc gtcgcggccc ttttggagcg ctacgccccc      1140
     cgtgaggtgg ccgtgttggc gcgctcttac gcggggctcg cgcagatgga gggggcgctg      1200
     cgcgcgctcg gggtgcccgc gaccatgctg caggggcgcg gctacttcga gcggctcgag      1260
     atccgcgacc tctaccacgc gctcaaagtc ggcctcgacc cgcaggggtt gtcgctggcg      1320
     gcgtggctgc ggggaccgtt cgcggggctc tcgctcggcg acgtcgagcg cgtcgtcctc      1380
     gccgaagcgc ccctggcgac cctcgagcgc ctcgcccccg aggtctctcg gcgcctcgag      1440
     cggctgcgcg aggtggtgcg gcgcggcccc gtcgaggcgc ttaagctgct cgtacgcgcg      1500
     ccgctcatcg gcgagaggcg ctacgtcgac tttttggagc cgcgcgcgcg cgaaaacgtc      1560
     gacgcgctgc ttttcgccgt ggcggcccac ccgcccccgg acgtcggggc gctgctcgag      1620
     aacctgaggc gcctcagccg ccaagaggac gcgggcgacg tgccgcagag cggcgacggg      1680
     gtctcgctcc tgacggtgca ccgcgccaag gggctcgagt ggcccgtggt cgcgcttttc      1740
     gacctcggcc gcttcgacac gccgcgcgcc gcagccctct acgtcgcgcc gggaagcggc      1800
     gaggtcgcgc ttgaggggag cggggcgttc gccgagctcg aggcggccgc gcgcgcccgt      1860
     gacgccgagg agagctaccg gctgctctac gtcgcggcgt cgcgggcgcg cgacgtgctc      1920
     ctcgtaagcg gtagcgtcaa aggggggcgc cccagggggt gggcggcggc gctcgcggcg      1980
     ctcggcttcg ggcccgaagc gcgcccctgg gcgcgcggcg acttcgtgct gcagcgctgg      2040
     ccggcgcaga gggtagcgcc agcggcagcg gcggttgcgg acgaaagggc gctccccgcc      2100
     gccccctgga ccacgcggcg ctttctcgaa ccgccgcaac cgcccctctg ctcgccttcg      2160
     gcggccgcta cccttggcga cgagggcgat gagagctgcg aaccgctccc gatcaccgat      2220
     cccgacgagg gggagccgct accggggcgc gcgcgcgcgg tcggcacgct cgtccactac      2280
     gcggtgtcgc aaaactggtc ggcgaggagc gcgacgcacc tgcgcaacct agaggcgcag      2340
     gaggtgatgt tcgcgtttag cgcggccgaa cgggcggaga tcctcgccga ggtcgccgag      2400
     ctgctcggcc gctacgaggc gctcctcgga gccgcgctgc cggcgctcga ggcgcgcgag      2460
     gccgacttcg ccgagctccc cttcgcgctg cccttcgcgg gtaccgtgtg gcaaggggtg      2520
     atcgaccggc tttactgcgc gggggggcgt tggtacctcg acgactacaa aaccgaccgc      2580
     accgttcggc ccgagagcta ctaccgccag ctcgggctct acgcccgtgc ggcgtgggcg      2640
     gtgcgcggtt tgcggcccga ggtgcggctc gtgtacctgc gggcgcagca ggtcgtccgg      2700
     gtacctgaag aggcgctcga gggggcgcta gaggcgctgt tggcgcgcgc cccacctgac      2760
     ttgaggtctg cctag                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page