(data stored in ACNUC30630 zone)

EMBL: CP002049.PE191

CP002049.PE191       Location/Qualifiers
FT   CDS_pept        complement(222104..222367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_07260 putative ABC transporter,
FT                   ATP-binding component; SPTR: C1D160 Putative ABC
FT                   transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13334"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX4"
FT                   /protein_id="ADI13334.1"
FT                   /translation="MAWEYLQVMMTTKPVKEGHSRLIVLGRGQEQAPIGAGTRLVDLLN
FT                   DLGAQGWELAGVLNLSSVDEPKAAHELHLTNSSLIFKRPLNP"
     atggcttggg aatacttgca ggtgatgatg acgaccaaac cggtgaaaga ggggcacagc        60
     cgcctgatcg tccttggccg cgggcaagag caggcgccca taggcgcggg cacccgcctc       120
     gtcgaccttc tcaacgacct cggcgcgcag ggttgggagc tcgcgggcgt tctcaacctc       180
     agctcggtcg acgaacccaa agcggcgcac gagctgcacc tgaccaactc gtcgctcatc       240
     tttaaacgcc ccctcaaccc gtag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page