(data stored in ACNUC30630 zone)

EMBL: CP002049.PE192

CP002049.PE192       Location/Qualifiers
FT   CDS_pept        222710..223774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0194"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="COGs: COG4663 TRAP-type mannitol/chloroaromatic
FT                   compound transport system periplasmic component; InterPro
FT                   IPR018389; KEGG: dat:HRM2_13970 periplasmic TRAP-type
FT                   dicarboxylate transporter protein; PFAM: Extracellular
FT                   solute-binding protein, family 7; SPTR: C0Q9E2 Periplasmic
FT                   TRAP-type dicarboxylate transporter protein; PFAM:
FT                   Bacterial extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13335"
FT                   /db_xref="GOA:D7CXX5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX5"
FT                   /protein_id="ADI13335.1"
FT                   /translation="MKRAWYRRIALTVGLASLLGVSAAQEVRWTMATSWPSSLNFHQLA
FT                   EEFAQNVERMSGGRMVIDVQPSGAIVGAFEVLDAVDSGIVEMGHSWSGYWIGRHPAAPF
FT                   FASIPMSFEAPMYMAWFYDAGGIELWNRLYQELMGLDITVMPVGVYHPETFAWSNVPIR
FT                   TLEDFQGLRYRTAGWWADILRDTGVSVVSLPAAELYPSLERGVVDAAEFSTPWADQTLS
FT                   FHEVTRYYTGPGMHQPAIVNELMINRSAWEALPEDLRAIVEAAAEAMVVRSWSRDLVRS
FT                   MEAVAFFDESGQERVEVDVETQRALREASFAYLDELATQDAFFAEVWESVQAFYDRYVE
FT                   YEAFMVPVRAEPRE"
     atgaagcgtg cttggtaccg acggatcgcg ctgacggtgg gtttggcgtc gcttttaggg        60
     gtgagcgcgg cccaggaggt tcgctggacg atggcgacct cgtggccctc gagcctcaac       120
     tttcaccagc tcgccgagga gttcgcgcag aacgtcgagc ggatgagcgg tgggcgcatg       180
     gttatcgacg tgcagccgag cggggcgatc gtgggcgctt tcgaggtgct cgacgcggtc       240
     gactcgggca tcgtcgagat ggggcactcc tggtcgggtt actggatcgg ccgtcacccg       300
     gcggcgccct ttttcgcctc catcccgatg tcgttcgagg cgcccatgta catggcctgg       360
     ttttacgacg cgggggggat cgagctgtgg aaccgcctct accaggagct gatgggtcta       420
     gacatcaccg tgatgcccgt cggggtctat caccccgaga cgttcgcgtg gagcaacgtc       480
     cccatccgca ccctcgagga ctttcagggg ctgcgctacc gcaccgccgg gtggtgggcc       540
     gacatcctgc gcgacaccgg ggtgtcggtc gtgtcgctgc ccgctgccga gctctacccc       600
     tcgctcgagc gcggcgtcgt cgacgccgcc gagtttagca ccccctgggc cgatcagacg       660
     ctcagcttcc acgaggtgac ccgctactac accggccccg ggatgcacca accggcgatc       720
     gtcaacgagc tcatgatcaa ccgcagcgcg tgggaagcgc tccccgaaga cctccgggcg       780
     atcgtcgagg cggccgccga ggcgatggtg gtgcgcagct ggtcgcgcga tctggtgcgc       840
     agcatggagg cggtggcctt tttcgacgag tcgggccaag agcgcgtcga ggtcgacgtc       900
     gagacgcagc gggcgctacg cgaggcgtcg tttgcctacc tcgacgaact ggcgacccag       960
     gacgcctttt tcgccgaggt gtgggagtcg gtacaagcgt tttacgaccg ctacgtcgag      1020
     tacgaggcgt ttatggtgcc ggtccgcgcg gagccgcgcg agtag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page