(data stored in ACNUC30630 zone)

EMBL: CP002049.PE207

CP002049.PE207       Location/Qualifiers
FT   CDS_pept        complement(244869..245891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0210"
FT                   /product="Transketolase central region"
FT                   /note="COGs: COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type beta
FT                   subunit; InterPro IPR005475:IPR005476:IPR009014:IPR015941;
FT                   KEGG: ttj:TTHA0938 pyruvate dehydrogenase E1 component,
FT                   beta subunit; PFAM: Transketolase central region;
FT                   Transketolase domain protein; SPTR: C1XT03
FT                   Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase component beta subunit; PFAM: Transketolase,
FT                   C-terminal domain; Transketolase, pyrimidine binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13350"
FT                   /db_xref="GOA:D7CXZ0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ0"
FT                   /protein_id="ADI13350.1"
FT                   /translation="MSALKDPETATRSATQNLTMVQAINQALEQALENDERVLLFGEDV
FT                   GKMGGVFRASDGLQGRFGEARVFDTPLAESGIVGFAVGIALAGFRPVAEVQFAGFLYPA
FT                   LDQILSHVGRYRHRTRGRYSLPLVVRAPYGGGVHTPEQHADSPEGLLAHTPGVKVVIPS
FT                   NPERAKGLLLAAVADPDPVFFLEAIKLYRSVRAAVPTSPYTHPLGKARVVREGGAATLL
FT                   CYGGMVEVCEKAAEVAQAEGVALEVLDLETLVPLDTEAVLASVRKTGRAVVVYEAMRTG
FT                   GFGAEVAARIAEEAIDSLQAPVLRVAGWDSPYPPFSSIEHHYRPNAKRVLEAVETLLRF
FT                   "
     gtgagcgcgc ttaaagaccc cgaaaccgcc acccggagcg cgacccaaaa cctgacgatg        60
     gtgcaggcga tcaaccaggc gctcgagcag gctttagaaa atgacgagcg cgtcctgctc       120
     ttcggcgaag acgtcggcaa gatgggcggg gtgtttcgcg cctccgacgg gctgcagggg       180
     cgtttcggcg aggcgcgggt gttcgacaca ccgctcgccg agtcgggcat cgtggggttt       240
     gccgtcggga tcgccctagc ggggtttcgg ccggtcgccg aggtgcagtt cgcgggcttt       300
     ctctacccag ccttggacca gatcctctcg cacgtcgggc gctaccgcca ccgcacgcgc       360
     gggcgctaca gcctgccgct ggtggtccgc gccccctacg gcggcggcgt ccacaccccc       420
     gagcagcacg ccgactcccc cgaggggctg ctggcgcaca cgcccggcgt aaaggtggtc       480
     atcccgtcga acccggagcg cgccaagggg ctcctgctcg cggccgtggc cgaccccgac       540
     ccggtctttt tcttggaggc gatcaagctc taccgctcgg tgcgcgccgc cgtcccgacg       600
     tccccctaca cccacccgct cggcaaggct cgagtggtgc gcgagggggg cgccgcgacg       660
     ctgctgtgct acggcggcat ggtcgaggtg tgcgaaaaag cggccgaggt cgcgcaggcc       720
     gagggggtag cgctcgaggt gctcgacctc gagaccctgg tccccttgga caccgaagcg       780
     gtgctcgcgt cggttcgcaa aacggggcgc gcggtggtcg tctacgaagc catgcgcacg       840
     ggtggtttcg gcgcggaggt cgccgccagg atcgccgagg aggccatcga cagcctccag       900
     gcgcccgtgc tgcgcgttgc cggttgggat tcaccctacc cgcccttttc gtccatcgaa       960
     catcactacc ggccgaacgc caagcgggtc ttagaagcgg tggaaacgct tctaagattt      1020
     taa                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page