(data stored in ACNUC30630 zone)

EMBL: CP002049.PE208

CP002049.PE208       Location/Qualifiers
FT   CDS_pept        complement(245878..246921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0211"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR017596:IPR001017; KEGG: tth:TTC0569
FT                   pyruvate decarboxylase alpha subunit-like protein; PFAM:
FT                   dehydrogenase E1 component; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: C1XT02 Pyruvate dehydrogenase
FT                   E1 component, alpha subunit; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl-transferring) E1 component, alpha
FT                   subunit; PFAM: Dehydrogenase E1 component; TIGRFAM:
FT                   pyruvate dehydrogenase E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13351"
FT                   /db_xref="GOA:D7CXZ1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ1"
FT                   /protein_id="ADI13351.1"
FT                   /translation="METLAYLSDEGIPKGNLPFDDDDLVRGYRALRRARFWDERASVLQ
FT                   RQGKLGVYPPYRGQEAAQVGTMLAFEPSDWLVPSYRESAAALTHGLPLATLILYWRAHP
FT                   AGWRFPEGVNILPFYVPIATQLPQAVGLAHALRLRGAQNGSQPIVATFVGDGGTSEGDF
FT                   HEALNFASVFEAPAVFIVQNNGWAISVPTTRQMKTKRVAARAAGYEMPGVTVDGNDLLA
FT                   VWKVAQEAVARAREGGGPTLIEAMTYRVAPHTTSDDPSRYRTEEEAASWIGRDPVKRMR
FT                   TALAHLTLWDDAQEEALLEELRAELEAAVREADDAPTPAPEEIVEHVFETMTPDQLRAW
FT                   EVLRERA"
     gtggagacgc ttgcttacct gagcgacgag gggatcccca agggcaacct accttttgac        60
     gacgacgatc tcgtgcgcgg ctaccgcgcg ctgcgccgcg cccgcttctg ggacgagcgc       120
     gcgagcgtcc tgcagcgcca gggcaaactg ggcgtgtacc cgccctatag gggacaggag       180
     gccgcgcagg tcggcaccat gctggccttt gagccctccg actggttggt gccctcctac       240
     cgcgagagcg ccgccgcgct gacgcacggc ctccctctgg cgaccctgat cctctactgg       300
     cgcgcgcacc ccgccgggtg gcgtttcccg gagggcgtga acatcctgcc gttctacgtc       360
     cccatcgcca cgcagctgcc gcaagcggtc ggcttggctc acgcgctgcg ccttcggggg       420
     gcgcaaaacg ggtcgcaacc catcgtcgca acctttgtcg gcgacggggg caccagcgag       480
     ggcgactttc acgaggcgct caacttcgcc tccgttttcg aggcgccggc ggtctttatc       540
     gtgcagaaca acggctgggc catctcggtg ccgacgacgc ggcagatgaa aaccaagcgc       600
     gtcgccgcgc gcgccgccgg ttacgagatg cccggcgtga cggtcgacgg caacgacctg       660
     cttgcggtgt ggaaggtcgc ccaagaggcg gtggcgcggg cgcgggaagg gggcgggcct       720
     accttgatcg aagcgatgac ctaccgcgtg gcgccgcaca ccacctcgga cgacccgagc       780
     cgctaccgca ccgaggagga ggcggcctcc tggatcggcc gcgaccccgt caaacggatg       840
     cgcacggcgc tcgcccacct tacgctgtgg gacgacgcgc aggaggaggc gcttttagag       900
     gagcttagag cggagctgga ggcggccgtc cgcgaggccg acgacgcccc cacccccgcc       960
     cccgaggaga tcgtcgaaca cgtcttcgag accatgaccc ccgaccaact gcgggcctgg      1020
     gaggtgctgc gtgagcgcgc ttaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page