(data stored in ACNUC30630 zone)

EMBL: CP002049.PE217

CP002049.PE217       Location/Qualifiers
FT   CDS_pept        256803..257717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0220"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: sru:SRU_2406
FT                   redox-sensitive transcriptional activator OxyR; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: Q2RZX6
FT                   Redox-sensitive transcriptional activator OxyR; PFAM:
FT                   Bacterial regulatory helix-turn-helix protein, lysR family;
FT                   LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13360"
FT                   /db_xref="GOA:D7CY00"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY00"
FT                   /protein_id="ADI13360.1"
FT                   /translation="MTLTQLKYLVAVAETGHFAEAAQRCGVTQPTLSMQLQKLERSLGI
FT                   VLFDRRKKPVEPTEAGATLVAQARRVLHECARLEGLAQEARGTVTGELRLGILPTLAPY
FT                   LLPLVVPRFLRRYPGVHLRVREATTAQLIGELVGNGLDLGLASDHEPHAALLSQPLFRE
FT                   PFVAFLAPEHRLAPHREIPTSALHVSDMWLLSEGHCLRDQTLRLCRGGELACGTRRSLH
FT                   FESGNLQTLVKLVKQSGGMTLLPLLATLDLSDGERRTYVRPLVPTPQREVWALTSRTSA
FT                   QRPLFRAFITTVLEALPENLAAL"
     atgacactca cccagctcaa gtacctggtc gccgtggccg aaacgggaca cttcgccgag        60
     gcggcgcagc gctgcggggt cacccaaccg accctaagca tgcagctgca aaagttggag       120
     cgctcgctcg gcatcgtgct ctttgatcgt cgcaaaaaac ccgtcgaacc gaccgaagcg       180
     ggggctacac tcgtcgcgca ggcgcggcgg gtgctgcacg agtgcgcgcg cctcgagggg       240
     ctcgcccaag aggcgcgcgg caccgtcacg ggcgagctgc gcctagggat cttaccgacg       300
     ctcgccccct atctgctgcc tttggtcgtc ccccgctttc tgcggcgcta ccccggcgtt       360
     cacctgcgcg tccgcgaggc gaccaccgcg caactcatcg gcgagctcgt gggtaacggg       420
     ctcgacctcg gcctcgcgtc ggaccacgag ccgcacgcag cgctcctctc gcagcccctc       480
     ttccgggagc cgttcgtcgc ctttctcgcg cccgagcacc gcctcgcccc ccaccgcgag       540
     atcccgacga gcgcgctgca cgtcagcgac atgtggctcc tcagcgaggg gcactgtttg       600
     cgcgaccaga ccctgaggct ctgtcgaggg ggggagctcg cctgcgggac gcgccgctcg       660
     ctgcacttcg agagcggcaa cctgcagacg ctcgtcaaac tggtcaagca gagcgggggg       720
     atgacgctgc tccctctgct cgccaccctg gatctcagcg acggcgagcg gcgcacctac       780
     gtgcggccgc tcgtcccgac gccgcagcgc gaggtgtggg cgctcaccag ccgcacctcc       840
     gcccaacgcc cgctcttccg ggcgtttatc acgaccgttt tggaggcgct gccggagaac       900
     ctcgcggccc tctag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page