(data stored in ACNUC30630 zone)

EMBL: CP002049.PE22

CP002049.PE22        Location/Qualifiers
FT   CDS_pept        24921..25226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0022"
FT                   /product="ribosomal protein L21"
FT                   /note="COGs: COG0261 Ribosomal protein L21; InterPro
FT                   IPR001787; KEGG: ttj:TTHA1783 50S ribosomal protein L21;
FT                   PFAM: ribosomal protein L21; SPTR: P60492 50S ribosomal
FT                   protein L21; TIGRFAM: ribosomal protein L21; PFAM:
FT                   Ribosomal prokaryotic L21 protein; TIGRFAM: ribosomal
FT                   protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13165"
FT                   /db_xref="GOA:D7CWS4"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS4"
FT                   /protein_id="ADI13165.1"
FT                   /translation="MFAIIQSGGKQYRVAEGDVVRLEALAAEPGETVELPVMMVAGDEI
FT                   KVGAPLVDGASVRAEVLGHGRGKKLYIYKFKAKSNYRRKTGHRQNYTEVRITHIAG"
     gtgtttgcaa ttatccagag tggcggaaaa cagtaccgcg tcgctgaggg cgacgtcgtg        60
     cgcctcgagg cgctcgccgc cgaacccggt gagacggtcg agctgccggt gatgatggta       120
     gcgggcgacg agatcaaagt cggcgcgccg ctcgtcgacg gggctagcgt gcgcgccgag       180
     gtgctcggcc acgggcgcgg caaaaagctc tacatctaca agttcaaagc gaagtccaac       240
     taccgccgta aaaccggcca ccggcagaac tacaccgagg ttcgtatcac gcacatcgcc       300
     ggctaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page