(data stored in ACNUC30630 zone)

EMBL: CP002049.PE225

CP002049.PE225       Location/Qualifiers
FT   CDS_pept        complement(264753..265964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0228"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="COGs: COG0373 Glutamyl-tRNA reductase; InterPro
FT                   IPR015895:IPR006151:IPR016040; KEGG: sti:Sthe_1800
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like; PRIAM: Glutamyl-tRNA reductase; SPTR:
FT                   C1XV36 Glutamyl-tRNA reductase; PFAM: Shikimate / quinate
FT                   5-dehydrogenase; Glutamyl-tRNAGlu reductase, N-terminal
FT                   domain; TIGRFAM: glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13368"
FT                   /db_xref="GOA:D7CY08"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY08"
FT                   /protein_id="ADI13368.1"
FT                   /translation="MERLALIGVSHRRGGAAALEAWQAAFKPPYSELAGLGFAEWVPIV
FT                   TCNRWDVVVALPKTMDVAQARALLTPTGQLCRPYAYTGDGALEQLTRIAASLDSLNPGE
FT                   DQIMAQVRSAFAAAQAAGSTGPLTSFAFHTALRIAKKVRREVALAPLKTSLFSLARPDL
FT                   LRALPQGGSVAVLGAGEMGSLAAKTLASEPGFDLLIVNRSAPRARQLARHLGARSSSLE
FT                   AFLAAPPPVDALVCATPVRALIDPLLVQRLPELKLIIDLGVPRNVHPEVIEASRVRVLD
FT                   VDTLQAAGRTRREALQEKLAAAEVILQEALEGALEAWTERQLGPSIQRLRQLYLATTLD
FT                   ALGDGVGSEEAARLAHRFAHVPVKGLRAVARTYGLEAAQMFLAEAGLGELRLGEAYAAD
FT                   ASRE"
     gtggaacgtt tagcgcttat cggcgtatcg caccggcgcg gcggagccgc cgccctcgaa        60
     gcctggcagg cggcctttaa acccccttac agcgagcttg caggcctggg cttcgccgag       120
     tgggtgccta tcgtcacctg caaccgctgg gatgtggtcg tcgctctacc caaaaccatg       180
     gacgtcgcgc aggctcgggc gctgctgacc ccgactgggc agctctgccg cccgtacgcc       240
     tacacgggcg acggggcctt ggagcagctc acccgcatcg ccgcctcgct cgactcgctc       300
     aacccgggcg aggaccagat catggcgcag gtccggagcg cgttcgcggc cgcgcaggcg       360
     gccggcagca cggggccttt gacctcgttc gcctttcaca cggccctgcg catcgccaaa       420
     aaggtgcgcc gcgaggtcgc cctagcgccc cttaaaacct cgctttttag cctcgcacgg       480
     cccgacctgt tgcgcgcgct cccccaaggg ggttcggtgg cggtgctcgg cgctggggag       540
     atggggtcgc tcgccgcgaa gacgctcgcc agcgagcccg gcttcgacct cctcatcgtc       600
     aaccgcagcg ccccgcgggc gcggcagctc gcgcggcacc tgggtgcgcg cagctcgagc       660
     ctcgaagcgt ttctggcagc gccgcccccc gtcgacgcct tggtgtgcgc gacgccggtg       720
     cgcgcgctga tcgacccctt gctcgtgcag cggctccccg agctcaagct gatcattgac       780
     ctcggggtgc cgcgcaacgt ccaccccgag gtcattgagg cctcgcgcgt ccgcgtgctc       840
     gacgtcgaca cgctgcaggc ggcgggccgg acgcggcgcg aggcgcttca agagaagctc       900
     gccgcggccg aggtgatcct ccaggaggcg ctggaggggg ccctcgaggc gtggacggag       960
     cggcagctcg gcccctccat ccagcggctt cggcagctct acctcgcgac cacgctcgac      1020
     gctttaggcg acggcgtcgg cagcgaggag gccgcccgcc tcgcccaccg cttcgcccac      1080
     gtgccggtca aggggttgcg cgccgtcgcc cgcacctacg ggctcgaggc ggcgcagatg      1140
     tttctggccg aagcggggct cggtgagctc cgcctcggcg aggcgtacgc cgcggacgcc      1200
     tcccgtgagt ag                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page