(data stored in ACNUC30630 zone)

EMBL: CP002049.PE234

CP002049.PE234       Location/Qualifiers
FT   CDS_pept        272124..274211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0237"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COGs: COG0855 Polyphosphate kinase; InterPro
FT                   IPR003414; KEGG: rrs:RoseRS_3717 polyphosphate kinase;
FT                   PFAM: Polyphosphate kinase; PRIAM: Polyphosphate kinase;
FT                   SPTR: A5UZL8 Polyphosphate kinase; PFAM: Polyphosphate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13377"
FT                   /db_xref="GOA:D7CY17"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY17"
FT                   /protein_id="ADI13377.1"
FT                   /translation="MAEPDLSDPKLYFNRELSWLQFNERVLEEAEDEENPLLERLKFLA
FT                   IFSTNLDEFIMIRYAGLKEQVAAGIVERSFDGLTPAEQLRAVSEALRPLIARHRKVLRQ
FT                   DVLPALEQHGLKLLSVGELAPSDREMVDDYFDRELFPVLTPLAVDSGHPFPRLPNLSFS
FT                   LLVELFDPDRGEAKTAVVQVPSVLPRFLRLPPLDDGDRTFRFVLSEEVIRSKVTALFPG
FT                   YEVRATYDFRLTRDADFEIAEDEADDLLQVIEDEVRKRRWGEAVRLEITARMPEHWADF
FT                   LRTTLKLSENDVYRVDNHLNVGDFMELTQLDLPELRYPPFNTRLPTEYRGRSDVFAIVR
FT                   QQDVLIHHPFHSFDAVLNMIEQAADDPDVLAIKQTLYRVGGRSPVVAALARASGNGKLV
FT                   TALVELKARFDEENNIVWARELERAGVHVVYGFAGLKTHCKALLIVRREGSEIRRYVHL
FT                   GTGNYNPGTSTVYTDFALLSCDPELGADVSELFNYLTGFSKQRSWRKLWVAPATLRGEL
FT                   AAAIEREEAHARAGGEGRIIAKMNSLVDPRVIRALYRASQAGVQCDLIVRGICCLRPGV
FT                   EGVSETIRVRSIVGRFLEHSRAFYFANGGDERLYLGSADWMQRNLTRRVEAVFPVEDPA
FT                   VKKKVMQVLDLCLRDNVKARELQPDGTYVRAKRKAGQRRLDAQERLLEISARRAALMGG
FT                   R"
     atggccgagc ccgacctgag cgaccctaag ctctacttca accgtgaact ctcgtggtta        60
     cagtttaacg aacgcgtcct cgaggaggcc gaggacgagg agaacccgct tttagagcgc       120
     ctgaagtttc tggcgatctt tagcaccaac ctagacgagt tcatcatgat ccgctacgcc       180
     gggctcaaag agcaggtcgc ggcggggatc gtcgagcgct cctttgacgg tctgacgcca       240
     gcggagcaac tgagggccgt ttcagaggcc ctcaggccgc tgatcgcgcg ccaccgcaag       300
     gtgctgcgcc aagacgtgct ccccgctttg gagcagcacg ggctcaagct gctttcggtc       360
     ggtgagctcg cgccgagcga tcgcgagatg gtcgacgact acttcgaccg ggagcttttc       420
     cccgtgctga cccccttggc ggtcgattcc ggccacccct ttccgcgcct gcccaacctg       480
     agcttttcgc tcctcgtcga gctcttcgac cccgatcgcg gcgaggccaa aaccgctgtc       540
     gtgcaggtgc cgagcgtgct gccgcgtttt ctgcggctgc cacccctcga tgacggcgac       600
     cgcaccttcc gcttcgtcct ctccgaggag gtcattcgca gcaaggtcac cgcgctgttt       660
     ccgggctatg aggtgcgcgc gacctacgac tttcggctga cgcgtgacgc cgacttcgag       720
     atcgccgagg acgaggccga cgaccttttg caggtgatcg aggacgaagt ccgtaagcgc       780
     cgttgggggg aggcggtgcg gctcgagatc accgcgcgta tgcccgagca ctgggccgac       840
     tttttgcgca cgaccctcaa gctcagcgaa aacgacgtct accgcgtcga caatcacctc       900
     aacgtcggcg actttatgga gctcacgcag ctcgacctcc ccgaactgcg ctacccgccc       960
     tttaacacgc gcctgccgac cgagtaccgc ggccgctccg acgttttcgc catcgtccgg      1020
     cagcaagacg tcttgatcca ccaccccttt cactcgttcg acgccgtttt gaacatgatc      1080
     gagcaggccg ccgacgaccc cgacgtgctc gccatcaaac agacgctcta ccgcgtcggg      1140
     gggagatcgc cggtcgtcgc ggcgctcgcc cgagcgtcgg gcaacggcaa gctggtcacg      1200
     gctctggtcg aactcaaagc gcgcttcgac gaggagaaca acatcgtctg ggcgcgcgag      1260
     ctcgagcgcg ccggggtgca cgtcgtctac ggctttgcgg gccttaaaac ccactgcaaa      1320
     gcgcttctga tcgtccgccg cgagggctcg gagatccgcc gctacgtcca cctcggtacg      1380
     gggaactaca accccggcac cagcaccgtc tacaccgact ttgcgctgct ctcttgcgac      1440
     cccgagttgg gcgctgacgt ctccgagctt ttcaactacc tcaccggctt ctccaaacag      1500
     cgcagctggc gcaagctgtg ggtggcgccg gcgacgctgc ggggcgagct cgccgcagct      1560
     atcgaacgcg aagaagcgca cgccagggcg ggcggggagg ggcgcatcat cgccaagatg      1620
     aattcgctcg tcgacccgcg cgtcatccgt gctctctacc gcgcatcaca agccggggtg      1680
     cagtgcgacc tcatcgttcg tggcatctgc tgtctgcgcc ccggcgtcga aggcgtcagc      1740
     gagacgattc gcgtgcgcag catcgtggga cgctttttgg agcattcgcg cgcgttctac      1800
     ttcgctaacg ggggcgacga acgcctctat ctgggttcgg ccgattggat gcagcgcaac      1860
     ctcacccgtc gggtcgaagc ggtcttcccc gtcgaggacc ccgcggtgaa aaagaaggtg      1920
     atgcaggtgc tcgacctgtg cttgcgcgac aacgtcaagg cgcgcgaact ccaacccgac      1980
     ggcacctacg tgcgcgccaa gcgcaaagct ggccagcgtc ggctcgacgc gcaggagcgc      2040
     ctgctggaga tttcagcgcg gcgcgctgcg ctgatggggg ggcgttag                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page