(data stored in ACNUC30630 zone)

EMBL: CP002049.PE247

CP002049.PE247       Location/Qualifiers
FT   CDS_pept        complement(292766..293422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0250"
FT                   /product="MOSC domain containing protein"
FT                   /note="COGs: COG2258 conserved hypothetical protein;
FT                   InterPro IPR005302:IPR011037:IPR015808; KEGG: dra:DR_1051
FT                   hypothetical protein; PFAM: MOSC domain containing protein;
FT                   SPTR: C1XRA3 Uncharacterized conserved protein; PFAM: MOSC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13390"
FT                   /db_xref="GOA:D7CY30"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY30"
FT                   /protein_id="ADI13390.1"
FT                   /translation="MQLLSVNVGQARAIVAKSGRSGIFKRATTERVRVTRDGLLGDTIC
FT                   DTENHGGPDQAVYLYGAPDYAWWSEQLGRTLAPGTFGENLTVSGLESATLQVGDRFRVG
FT                   EVVLEVTAPRIPCVTLAVRMGDPAFVKRFRHAERPGVYCRVLHEGDVWAGAEVRLEPYT
FT                   GATVGVLELFRDFFRPERDEKTLRRHLAAPIASRDRAAKEAALAALRERGDPHAP"
     atgcagcttc tcagcgtcaa cgttggtcag gccagggcga tcgtggccaa gagcgggcgc        60
     tcgggtatct tcaaacgcgc tactacagaa cgggtgcggg tgacccgtga cggcctcctg       120
     ggcgacacga tctgcgacac cgagaaccac gggggaccgg accaagcggt ctacctctac       180
     ggcgccccgg actacgcgtg gtggtccgag cagttggggc gaacgctggc gcccggcacc       240
     ttcggtgaaa acctcacggt gagcggccta gaaagtgcca cgttacaggt aggcgaccgg       300
     ttcagggtcg gggaggtggt gctcgaggtg accgccccgc gcatcccgtg cgtcaccctt       360
     gcggtgcgga tgggggaccc ggctttcgtg aagcgcttcc gccacgccga gcgccccggc       420
     gtctactgcc gcgtgttgca cgagggggac gtgtgggcgg gcgccgaggt gcggctcgag       480
     ccctacacgg gggctaccgt aggggtgctc gagctgtttc gcgacttttt tcggccggag       540
     cgcgacgaaa agacgcttcg ccgccacctc gccgcgccca tcgcctcccg cgaccgcgcg       600
     gccaaagagg cggcgttagc ggcgcttcgg gagcgcggcg acccgcacgc gccttag          657
//

If you have problems or comments...

PBIL Back to PBIL home page