(data stored in ACNUC30630 zone)

EMBL: CP002049.PE256

CP002049.PE256       Location/Qualifiers
FT   CDS_pept        complement(303539..304684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0259"
FT                   /product="S-layer domain protein"
FT                   /note="InterPro IPR001119:IPR005474; KEGG: dge:Dgeo_1597
FT                   S-layer-like protein region; PFAM: S-layer domain protein;
FT                   SPTR: Q1IXZ2 S-layer-like protein region; PFAM: S-layer
FT                   homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13399"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY39"
FT                   /protein_id="ADI13399.1"
FT                   /translation="MKKLALALGTTLVVGGALAQTSFPDVPEDNFAAEAVAELVELGIL
FT                   TGFPDGTFRGNEAFTRYQAAIVISRLLDVLEENAAAASALSEEDLATLNNAVQELSTGL
FT                   DELFARVEALEAAAPDADATALSEEVSALGERLGALEAAGPDTALAEQLAALEERVAAL
FT                   EAAGAEAPAVDVAALQEQVTALNAQVNDLQARLEAAPAPEAELDVTEAAPEEPAVDLTA
FT                   PVAAPAAVTAPERGKFFLGLGSFYETDSADIGSRFRPRVTLGLDDLVAGFGLRATADYG
FT                   RQTLIEAGSLAFSGHLTYTLGVSAVSAYLGVGGGYQFPDLLFVTNTFEGPFAGALLGAE
FT                   FGTGPVTFFVEGTADYYLDGAPAEGYNQLYPTIAAGLNLRP"
     atgaaaaaac tggctctagc cctcggaacg accctcgtcg tgggtggtgc gctcgcccag        60
     acgtcgttcc ccgacgttcc cgaagacaac ttcgccgccg aggcggtcgc cgagctcgtc       120
     gaactcggca tcctcaccgg ctttccggat ggcacctttc gcggcaacga agccttcacc       180
     cgctaccagg ccgccatcgt catcagccgc cttttagacg tgctcgagga gaacgcggcg       240
     gccgccagcg cgctgagcga agaggacctg gcgacgctga ataacgccgt gcaggagctc       300
     tcgactggcc tcgacgagct gttcgcgcgc gtcgaagcgc tcgaggcggc cgcgccggac       360
     gccgacgcca ccgccctcag cgaggaggtc agcgcccttg gtgagcgcct gggtgccctc       420
     gaggcggcgg gccctgatac cgccctggcc gagcagctcg cggcgctcga ggagcgcgtc       480
     gccgcgctcg aggcggccgg cgccgaagcc cccgcggtcg acgtcgccgc gctccaggag       540
     caggtcacgg cgcttaacgc gcaggtcaac gacctgcagg cgcgcctcga ggcggcgccg       600
     gcccccgaag cggagctcga cgtgacggaa gcggcaccgg aggaacccgc ggtcgacctc       660
     accgcgccgg tcgctgcccc cgcggcggtg acggctcccg agcgcggcaa gttcttcctc       720
     ggtttgggct ccttttacga aaccgacagc gccgacatcg gttcgcgctt ccgcccccgc       780
     gtcacgctgg gcctcgacga cctcgtggcg ggcttcgggc tccgagcgac cgccgactac       840
     ggccgtcaga cgctcatcga agcgggttcg ctcgccttct cgggtcacct gacctacacc       900
     ctcggggtga gcgccgtgag cgcctacctc ggcgtcggcg gcgggtacca gttccccgac       960
     ctgctctttg tcaccaacac cttcgagggt cccttcgcgg gggcgctcct cggcgcggag      1020
     ttcggcacgg gtcccgtcac cttcttcgtc gaagggaccg ccgactacta cctcgacggc      1080
     gcgccggccg agggttacaa ccagctctac ccgacgatcg ccgccgggtt gaacctccgc      1140
     ccgtaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page