(data stored in ACNUC30630 zone)

EMBL: CP002049.PE26

CP002049.PE26        Location/Qualifiers
FT   CDS_pept        27726..28319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0026"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1713 HD superfamily hydrolase involved in
FT                   NAD metabolism; InterPro IPR005249:IPR006674:IPR003607;
FT                   KEGG: tth:TTC1420 metal dependent phosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR: C1XI98
FT                   Metal dependent phosphohydrolase; PFAM: HD domain; TIGRFAM:
FT                   conserved hypothetical protein TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13169"
FT                   /db_xref="GOA:D7CWS8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS8"
FT                   /protein_id="ADI13169.1"
FT                   /translation="MRNTLFTVNSPCTRPSILPYCERVKERVTPKRFEHIVRVAILTET
FT                   IAQANRFDRGELRAACLAAVLHDVARDLSAEELFALAPPETELEREHPLAVHGRAGRRI
FT                   AESWGVSDERVLAAIEGHVFGVAHDNRIGMALYVADVSEPGRGVNHDIRELAMHNLFRA
FT                   YQRAVNTKVAYLRSRGKTVHPVTLRVYREICGAL"
     ttgagaaaca cgctctttac cgttaacagc ccctgtacgc gccccagcat cctgccctac        60
     tgcgagcgcg tcaaagagcg ggtgacgccg aagcgcttcg agcacatcgt gcgcgtcgcg       120
     atcctcaccg agacgatcgc ccaggccaac cgcttcgacc gcggtgagct gcgcgcggcc       180
     tgtttggcgg cggttctcca cgacgtcgcg cgcgacctga gcgccgagga gctctttgcg       240
     ctcgcgccgc cggagaccga gctcgagcgc gaacacccgc tcgcggtgca cggccgcgcg       300
     gggcggcgca tcgccgagag ctggggggtc agcgacgaac gggtgctcgc ggccatcgag       360
     gggcacgtgt tcggggtcgc ccacgacaac cgcatcggca tggcgctcta cgtcgccgac       420
     gtctccgagc cggggcgcgg cgtcaaccac gacatccgcg agctcgccat gcacaacctg       480
     ttccgcgcct atcagcgtgc ggtgaacacc aaagtcgcct acttgcgctc ccgtggcaaa       540
     accgtgcatc cggtgacgct gcgcgtctac cgcgaaatct gtggtgccct ctag             594
//

If you have problems or comments...

PBIL Back to PBIL home page