(data stored in ACNUC30630 zone)

EMBL: CP002049.PE278

CP002049.PE278       Location/Qualifiers
FT   CDS_pept        326464..329673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0281"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="COGs: COG4219 Antirepressor regulating drug
FT                   resistance predicted signal transduction N-terminal
FT                   membrane component;
FT                   InterProIPR008756:IPR013784:IPR008969:IPR008957:IPR 018062;
FT                   KEGG: sus:Acid_0899 peptidase M56, BlaR1; PFAM: peptidase
FT                   M56 BlaR1; SPTR: Q09BI6 TonB domain/peptidase M56 domain
FT                   protein; PFAM: BlaR1 peptidase M56"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13421"
FT                   /db_xref="GOA:D7CR21"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR21"
FT                   /protein_id="ADI13421.1"
FT                   /translation="MSARALLEHPLAEAVGWALLHSLWQGALVGALVALGLFALRRPQH
FT                   RYALGCGALLLMVVLPLLTGVLHYRDLTAPLAASGELGPSSFIPSGGLVGDAAPSVAPP
FT                   ASSSSSSAIPTGTPSAASSSVAQVWGRVSHTLTSSAPWFTGLWLVGVALSLLRLLGSAL
FT                   YAARFGARHRTPAPEAWQQTFRTLAGRLGLRRVPRLVLSSDVDTPLVLGVLRPLVVLPV
FT                   SALTGVPAAQLSAVLLHELAHIRRYDPLVNLLQCLLETLLFYHPAVWWISRAVRREREA
FT                   CCDDLAVAVCGDARLYARALVGLEALRQREPALALAATDKPLLERVRRLLGMESDVRSA
FT                   PSLLTVLLVVTLSLGVGLFLTLQPAVAQEEAPSTSLQVAEDETVVTGRVLWQGEPVAGV
FT                   RLELHSRLELDDDGVCCREPRVLASTTSDEDGTYTFRVSAARAFTIWAYPPTSDYLPVG
FT                   YDHVSTPGIPFQANVQLMKAIKELEPALTYGVNLTPTLSWQPLPEAARYGVSITKLNET
FT                   DTVMENYQYTAEPQFTVETPLEENALYYWVVEAYDETGTTLAYGESTFSTSSAQARVPV
FT                   ELTDVGVRTVLPAGWQLVGAGAFEQVTEGGERRRLTFERLPGDDPEAVLRARNESSSAP
FT                   TESAYGDQTWLWQAGSDRDGRRFVQATTVGGNVYLITAEATDESPVELYAFVLPLVLEN
FT                   FEVIGADEGDNGAGAAPPGTSQHLPALALRRSDNRDAEVFTPAPETGTVAGTVRWHHTP
FT                   LAGVRVSLRTPRERLEDGSCCVGEQETLQTVSTDENGTYRFEGVTPGEYEVEAEAPSSL
FT                   YWEFMSSSVNVSAAFEVREDFRLQKVMEVVSPHGEMGVPLSPTLRWKPFPGAARYQTYI
FT                   HSERTGNQVRSLPSESTEVTLNAPLEPNELYQWSVTAYAEDGTEIAYYSAAHFSTAPAK
FT                   EQVSVTLPDLGLQMMLFEDWQQVTSNTFEWAHEGGTTYTLAFQTLPGDDAEAALLELGA
FT                   TEEQVHASSYEGKTWWTGVFNGVVRLATELEGQVYLIAADSSPDGTAEFSYAAEVEALG
FT                   FTLPLVARTLERVGAVAEGRA"
     gtgagcgcta gagcgctgct cgagcacccg ctcgccgagg cggtcggttg ggcgctgctg        60
     cactcgctct ggcagggagc gctcgtgggc gcgctcgtcg cgctcgggct cttcgcgctg       120
     cgccgcccgc agcaccgcta cgccttgggc tgcggcgcac tgcttctgat ggtggtgcta       180
     ccccttctga cgggggtgct gcactaccgc gacctcaccg cgccgctcgc cgcatccggg       240
     gagctggggc cctcctcttt catccccagc ggcggcctgg tcggtgacgc tgccccctcg       300
     gtagcgcccc ctgcaagctc ttcaagctct tcggcaatcc ccacgggtac cccctcagcc       360
     gcttcgtcct cagtggcaca ggtttggggg cgagtctccc acacgcttac cagcagcgct       420
     ccttggttca ccggcctctg gcttgtcggc gtcgcgcttt ccttgctgcg gcttcttggc       480
     agcgcgctct acgccgcccg ctttggtgcg cgccaccgga ccccggcccc ggaagcgtgg       540
     caacagacct ttcggacgtt ggcggggcgg ctcggtctgc gccgcgtccc gcgcctcgtg       600
     ctttcaagcg acgtggatac gcccctcgtg ctcggcgtcc tgcggccctt ggtggtgctg       660
     cccgtgagcg ccctcaccgg cgttccggcg gcgcagctct cggccgtgct gctccacgaa       720
     ctcgcccaca tccggcggta cgacccgctc gtcaacctct tgcagtgcct ccttgagacc       780
     ctgctgttct atcacccagc cgtgtggtgg atctcgcgcg ccgtgcgccg cgagcgcgag       840
     gcgtgctgcg acgacctcgc ggtggcggtc tgtggggacg cgcggctcta cgcgcgggcc       900
     ttggtggggc tcgaggcgct gcgccaacgg gagcccgcgc tggcgctcgc cgcgacggac       960
     aaaccgcttt tggagcgggt gaggaggtta ctcggtatgg aatccgacgt tcgttctgca      1020
     ccttcactgc tgacggtgct gctggttgtc accttgtcgt taggcgtggg actcttcttg      1080
     acgctgcaac ctgcggttgc acaagaggag gcgccttcta cttctttgca agttgctgaa      1140
     gacgaaacgg tcgtgacggg gcgcgtgctc tggcaaggtg agcccgtcgc gggggtgcgc      1200
     ctcgagcttc atagccgcct cgagctggac gacgacggtg tctgctgccg agagccgcgc      1260
     gtgttggcga gcacgacctc ggatgaagat gggacctata cctttcgggt aagcgcggcg      1320
     cgtgctttca ccatctgggc gtatccacct acaagcgact atctaccggt gggctacgac      1380
     cacgtatcta cccctggtat tccatttcaa gcgaacgttc agctcatgaa ggccattaaa      1440
     gaactagaac ctgctttgac ctatggggtc aacctcacgc cgacgctaag ctggcagcct      1500
     cttccagaag ctgcgcggta cggagtaagc atcacaaagc tgaatgaaac cgatacagta      1560
     atggaaaatt atcaatatac ggctgagccg cagttcacgg tagaaacgcc gctcgaggaa      1620
     aatgccctct actactgggt ggtggaagcg tacgatgaga ctggcacgac gcttgcttat      1680
     ggtgaatcga ccttttctac ttcctcagcg caggcgcgcg tacctgtaga gctgacggat      1740
     gtgggtgttc gtaccgtcct gccggctggt tggcagttgg taggggcggg cgctttcgag      1800
     caggttaccg aaggcggcga gcggcgcagg ttgacgttcg agaggcttcc cggcgacgac      1860
     cccgaggcgg tgctaagggc tcgcaacgag tcctcgagcg cccctaccga gagcgcctat      1920
     ggagaccaaa cgtggctgtg gcaagccgga agtgaccgcg acggacggcg cttcgttcaa      1980
     gcgacgaccg taggcggtaa cgtttatctc ataacagcag aagcaacaga cgagtctccg      2040
     gtagagcttt acgcctttgt tctgccgctc gtgctggaaa acttcgaggt tataggggct      2100
     gatgaagggg acaatggcgc gggtgcagca cctcctggaa caagccaaca cctgccggcc      2160
     cttgcactgc ggcgcagcga caatcgagat gctgaggtct ttactccagc ccctgagacc      2220
     ggaaccgtag cgggcaccgt gagatggcac cacaccccgc tcgccggggt gcgggtcagc      2280
     ttgaggacgc ctcgagagcg cctcgaggac ggaagctgct gcgtaggcga gcaggagacg      2340
     cttcagaccg ttagcacgga cgaaaatggt acgtaccgtt ttgagggggt gacgccgggt      2400
     gagtacgaag tggaggcgga ggcgccctcg agcctctact gggagtttat gagcagcagt      2460
     gtgaacgtga gcgccgcctt cgaggtgcgg gaagacttcc gcttacaaaa agttatggag      2520
     gtggtcagcc ctcatggaga gatgggggtg cctctctcac cgacactgcg ttggaagccc      2580
     ttccctggtg cagcgcggta tcagacgtat atccatagcg agcgaacggg taatcaggta      2640
     aggagcttgc cgtccgaaag caccgaggtg acgctgaacg cgccgctcga gcccaacgaa      2700
     ctctatcagt ggtcggtcac tgcatatgca gaggacggta ctgaaatcgc ctactactcc      2760
     gctgcacact tctccaccgc gccagccaag gagcaggtct ccgtcaccct gcccgacctc      2820
     ggccttcaga tgatgctttt cgaggattgg cagcaagtca cgtccaacac gtttgagtgg      2880
     gcacacgagg gcggcacgac ctacaccttg gcgtttcaga cgttgcctgg agatgacgcc      2940
     gaggcggcgc tgctcgagtt aggcgctaca gaggagcagg tacacgcctc tagctatgag      3000
     ggcaagacgt ggtggacggg cgtgtttaat ggcgtcgttc gtctcgcgac cgaactggag      3060
     gggcaggttt acctcatcgc ggccgatagc agcccggacg gtacggctga gttctcttat      3120
     gctgcggagg ttgaagccct cgggttcacg ctgcctctag tggcgcggac gctcgagcgg      3180
     gttggcgcgg tggctgaagg tcgagcgtaa                                       3210
//

If you have problems or comments...

PBIL Back to PBIL home page