(data stored in ACNUC30630 zone)

EMBL: CP002049.PE308

CP002049.PE308       Location/Qualifiers
FT   CDS_pept        complement(362070..362849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0312"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COGs: COG1043 Acyl-(acyl carrier protein); InterPro
FT                   IPR001451:IPR010137:IPR011004; KEGG: noc:Noc_1752
FT                   UDP-N-acetylglucosamine acyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein;
FT                   PRIAM:Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc
FT                   osamineO-acyltransferase; SPTR: C1XSC2
FT                   Acyl-(Acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase;
FT                   TIGRFAM:acyl-[acyl-carrier-protein]--UDP-N-acetylgl
FT                   ucosamineO-acyltransferase; TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13451"
FT                   /db_xref="GOA:D7CRG1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG1"
FT                   /protein_id="ADI13451.1"
FT                   /translation="MNPEPAPPEVHPSAVVHDGATLGPGCRVGPFVVVEADVTVGAQSV
FT                   LEAGTVLQRGSRVGARCRLGPYATVGGEPMDTKFRGEPSYAVLEDEVVLREFASVHRAS
FT                   GEGQATRVGRKTLVMAYAHVSHNVQVGQGCVLTTQVQLGGHSEVGDFAVLGSAALLHQG
FT                   CRVGAYAMYGAGSAANQDILPYSMARGNPARHYRLNRVGLTRHGVTGERYRALERAVRA
FT                   FRRRDWALLEALALESAEVRTMLDFRARSKRGLCGFV"
     gtgaaccccg aacccgcccc ccccgaggtg cacccgagcg cggttgttca cgacggcgcg        60
     accctcggac cggggtgccg cgtcggccct ttcgtggtcg tcgaggcgga cgtcacggtc       120
     ggggcgcaga gcgtgctcga ggcgggtacg gtgctccagc gcggcagccg cgtcggcgcg       180
     cgctgccgct tggggcccta cgcgaccgtg ggcggcgaac cgatggacac caagtttcgg       240
     ggggagccga gctacgccgt tttggaggac gaggtggtgc tgcgcgagtt cgccagcgtg       300
     caccgcgcga gcggcgaggg ccaagcgacg cgggtcggcc gcaagacgct ggtgatggcc       360
     tacgcgcacg tctcgcacaa cgtgcaagtc ggccaggggt gcgtgctcac cacccaggtg       420
     cagctcggcg gccacagcga ggtcggcgac ttcgcggtgc tcggttcggc ggccctcttg       480
     caccagggct gccgcgtcgg cgcctacgcc atgtacggcg cgggcagcgc cgccaaccag       540
     gacatcttgc cctacagcat ggcgcgcggc aacccggcgc ggcactaccg gctcaaccgc       600
     gtcgggctga cgcgccacgg cgtcaccggc gagcgctacc gggcgctcga gcgcgccgtg       660
     cgcgcctttc gccgccgcga ctgggcgctt ttggaggcgc tcgcgctcga gagcgccgag       720
     gtgcgcacca tgctcgactt tagggcgcgt tccaaacggg ggttatgcgg cttcgtgtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page