(data stored in ACNUC30630 zone)

EMBL: CP002049.PE312

CP002049.PE312       Location/Qualifiers
FT   CDS_pept        complement(365342..368206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0316"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="COGs: COG1044 UDP-3-O-(3-hydroxymyristoyl); InterPro
FT                   IPR018357:IPR001451:IPR011004:IPR007691; KEGG:
FT                   mrd:Mrad2831_3438 UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; SPTR: C1XGQ5
FT                   UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase;
FT                   TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; TIGRFAM: UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13455"
FT                   /db_xref="GOA:D7CRG5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG5"
FT                   /protein_id="ADI13455.1"
FT                   /translation="MRPALRRLALLGALLLPTALAQGAAAPPPPAERAGDTPLFPLGAL
FT                   EAGARGYALTTGANNRPERLEVEVIALQYDLGTAFPLVLVETSGPLVERAGGIAAGMSG
FT                   SPVYLPYGGEDALLGAIGFTFPDGSGGLGLVTPIGAMRQAEAPEARPAAFGPPFDPRAA
FT                   APVRTPLLLEGLSGRAARLLGPLLAAQGLPATLQVPTRLQVQGRAGAPPHADADAAFEP
FT                   APGGAVSVQLVRGDLTVAAVGTLTLVEGGRFWAFGHPLLNQGEVSFALAPAYVTAVVPN
FT                   RTLPFKLADSGRRVLGAVTQDRPAALSGTLGEAPQFVPVTLTLQRGEAQASAHLEVTAL
FT                   EALFAPLLATASLQLLDDFLAETRGGTAELAWEIALRGGRTLRLLAQTTDPADIALVTA
FT                   ALAAEPLALLAENPFRAPGLGRVALHVALERDARVAEIADVVLEDAVVPAGGSVGVNVR
FT                   LQPFRQDPVVQRLSVPLPEALAGEVELTVRGGLSPLEADDAGAPPLSFEEFLAGLERSV
FT                   QARELVVEAFVGGELQLLTRQLLPHLVSGSVTRSVTVEGPADAADPAADTETDPETGGA
FT                   APPRRRHPTPRGAPLGRSPPHPAAGGPAVRPHPITAAQLAAQLGGRLEGDDRPVTALAD
FT                   PTAALPDSAVVVTSAAALEALSTQPVAAQLGALVLPDALCPAPRVACPIIWVRDVRLAL
FT                   ARLSALFAPPPPRPQLSDGAVVAPDATLGEAVSVGAGAVIGAGAVIGAGSRVGPGCVLG
FT                   EGVTLGPDCVLHANVTLYPGTALGARVIVHSGAVLGADGFGYAFGPQGAVKIHHLGGVV
FT                   IEDDVEVGANTCIDRGTLLDTRVGARTKIDNLCQIGHNVQIGPDCVIAGGSAIGGSTVL
FT                   ERGVLLGGAVAVTDHVRLGAGARVGGRSSVTKSVPAGETWAGYPAKPQRKWVRELYLIG
FT                   KLEAIWASVRAQGRPVSGARTGDD"
     atgcgccccg ctctacgccg cctcgccctc ctcggtgcgc tcttgttgcc caccgcgctc        60
     gcccagggag ccgcagcgcc tccgccccca gcggagcgcg ccggcgacac cccgctgttt       120
     ccgctcgggg cgctcgaggc cggcgcccgc ggctacgccc tgacgaccgg cgcgaacaac       180
     cgcccagagc gcctcgaggt cgaggtgatc gccctgcagt acgacctcgg cacggccttt       240
     ccgctcgtgc tggtagagac ctcggggccg ctcgtcgagc gcgccggggg gatcgccgcg       300
     gggatgagcg ggagcccggt ctacctccct tacgggggtg aagacgcgct cctgggcgcg       360
     atcggtttta cctttcccga cgggagcggc gggctcggcc tcgtcacgcc catcggggcg       420
     atgcgtcagg ccgaagcgcc cgaagcgcgc cccgcggcct tcggcccccc cttcgacccg       480
     cgcgccgccg caccggtccg gacgccgctc ctcctcgaag ggctctcggg ccgcgccgcg       540
     aggctgcttg ggcccctgtt ggcggcgcag gggctgccgg ccaccctgca ggtgccgacc       600
     cggctccagg tgcaggggcg ggccggcgcc ccgcctcacg ccgacgccga cgcggccttt       660
     gaacccgcgc cgggcggggc ggtgagcgtg cagctcgtcc gcggcgacct caccgtggcc       720
     gccgtcggga ccctgacgct cgtcgagggg gggcgcttct gggctttcgg gcacccgctc       780
     ctcaaccagg gggaggtctc gttcgcgctc gcccccgcct acgtcaccgc cgtcgtcccc       840
     aaccgcacgc tgccctttaa gctcgccgac agcggccggc gggtgctcgg cgccgtgacg       900
     caagaccggc ccgcggcgct gagcggcacg ctcggcgagg cgccccagtt cgtccccgtc       960
     acgctcacct tgcagcgcgg tgaagcgcag gcttcagccc acctcgaggt caccgcgtta      1020
     gaggcgctct tcgcccccct gctggccacc gccagcctcc agctgctcga cgactttttg      1080
     gccgagaccc gcggcggcac cgccgagctc gcctgggaga tcgcgctgcg cggcggccgg      1140
     acgctgcggc tcctggcgca gacgaccgac cccgccgaca tcgccctggt gacggcggcg      1200
     ctcgccgccg agcccctggc gctcctcgcc gagaacccct ttcgggcgcc cgggctgggg      1260
     cgcgtcgcgt tgcacgtcgc tttggagcgc gacgcgcgcg tcgccgagat cgccgacgtc      1320
     gtgttggaag acgcggtcgt ccccgcgggg gggagcgtgg gcgtcaacgt gcggctgcaa      1380
     ccctttcgcc aagaccccgt ggtgcagcgc ctcagcgtgc ccctccccga ggcgctcgcg      1440
     ggggaggtcg agctgaccgt gcgcggcggc ctctcccccc tcgaggccga cgacgccggc      1500
     gcccccccgc tctctttcga ggagtttctc gccgggctcg aacggagcgt tcaggcccgc      1560
     gagctcgtcg tcgaagcgtt tgtgggcggc gagctgcagc tgctcacgcg ccaactgctg      1620
     ccccacctcg tgtcggggag cgtgacgcgc tctgtcaccg tcgagggtcc ggcagacgcc      1680
     gccgaccccg cagccgacac cgaaaccgac cccgagacgg ggggggccgc tcccccccgc      1740
     cgacgacacc ccaccccccg aggagccccc cttggacgat ccccccctca ccccgccgcc      1800
     ggaggcccgg ccgtgaggcc gcaccccatc accgccgcgc agctcgccgc gcagctcggt      1860
     gggcgcctcg agggcgacga ccgccccgtc accgccctcg ccgaccctac cgccgcgctc      1920
     cccgacagcg ccgtcgtggt cacctccgcc gccgcgctag aggcgctcag cacacaaccc      1980
     gtagcggcgc agctcggcgc gctcgtcctc cccgacgcgc tttgcccagc cccccgcgtc      2040
     gcctgcccga tcatctgggt gcgcgacgtg cgcctcgcgc tcgctcgcct cagcgccctc      2100
     ttcgccccgc ccccaccccg accgcagctg agcgacgggg cggtcgtcgc gcccgacgcc      2160
     accctgggcg aagcggttag cgtcggcgcg ggggcggtga tcggcgcggg ggcggtgatc      2220
     ggcgcgggga gccgcgtcgg tccggggtgc gtgctcggcg agggcgtcac gctcggaccc      2280
     gactgcgtgc tgcacgccaa cgtcaccctc taccccggca ccgcgctcgg cgcgcgggtg      2340
     atcgtccata gcggcgcggt gctcggcgcc gacggtttcg gctacgcctt cggcccgcaa      2400
     ggggcggtca agatccacca cctgggcggg gtcgtcatcg aagacgacgt cgaggtcggc      2460
     gcgaacacct gtatcgaccg cggtaccctg ctcgacaccc gcgtcggcgc gcgcacgaag      2520
     atcgacaacc tctgccagat cggccacaac gtgcagatcg gccccgactg cgtcatcgcg      2580
     ggggggagcg caatcggcgg cagcaccgtt ttggagcgcg gcgtcctttt ggggggcgcg      2640
     gtcgccgtga ccgaccacgt gcgcctcggc gccggcgccc gcgtcggggg gcgctcgagc      2700
     gtcaccaaaa gcgtcccggc cggggagacc tgggcgggct accccgccaa accgcagcgc      2760
     aaatgggtgc gcgagctcta ccttatcggt aagctcgagg ccatctgggc gagcgtcagg      2820
     gcgcagggac gtcccgtgag cggcgcgcgg acgggggatg actag                      2865
//

If you have problems or comments...

PBIL Back to PBIL home page