(data stored in ACNUC30630 zone)

EMBL: CP002049.PE315

CP002049.PE315       Location/Qualifiers
FT   CDS_pept        complement(370194..370430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B8A0H0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13458"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG8"
FT                   /protein_id="ADI13458.1"
FT                   /translation="MQTPPPTPERASREEYGREVERIRKLIEHIHAQAERLQRAAEALP
FT                   DELGERLEEKADELLHKADELRDEAKELEAGAS"
     atgcagacgc caccccccac cccggagcgc gcgagccgcg aggagtacgg gcgcgaagtc        60
     gaacgcatcc gcaaactcat cgagcacatc cacgcgcaag cggagcggct tcagcgggcc       120
     gccgaagccc tccccgacga actcggcgaa cgcctcgagg agaaagccga cgagcttttg       180
     cacaaggccg acgaactgcg cgacgaggcc aaagagctcg aggccggagc cagctaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page