(data stored in ACNUC30630 zone)

EMBL: CP002049.PE334

CP002049.PE334       Location/Qualifiers
FT   CDS_pept        387818..388414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0338"
FT                   /product="protein of unknown function DUF88"
FT                   /note="COGs: COG1432 conserved hypothetical protein;
FT                   InterPro IPR002790; KEGG: ttj:TTHA1057 hypothetical
FT                   protein; PFAM: protein of unknown function DUF88; SPTR:
FT                   B7A7J0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13477"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI7"
FT                   /protein_id="ADI13477.1"
FT                   /translation="MTQRDPLDEDRLQPTKPAANHRFDPNAARIGEWPEQRVGLFVDTQ
FT                   NLYYAARDIYSRHVDYAVMLKLSERSRHLVHATAYVVEREGEATAYGFVTKLSALGYRV
FT                   RRRKVRVHRADSGGRPVLEGDWDMGIAADIVRAWDYLDVIVLASGDGDFAPMLELAQQR
FT                   GKRVEVLAFREAASQNLLDLADAFMGLADVPDIFV"
     gtgacgcagc gagacccgtt ggacgaggac cgattgcaac cgaccaagcc cgccgccaat        60
     caccgcttcg atccgaacgc ggcgcgtatc ggggagtggc cggagcagcg cgtcgggctc       120
     tttgtcgata cccaaaacct ctactacgcc gcgcgcgaca tctatagccg ccacgtcgac       180
     tacgcggtta tgctcaagct gagcgagcgc tcgaggcacc tcgtgcacgc gaccgcctac       240
     gtcgtcgagc gcgagggcga ggcgaccgcc tacggtttcg tcaccaagct ctcggcccta       300
     ggctaccgcg tgcgccgccg caaggtgcgc gtgcaccgcg ccgacagcgg cgggcggccc       360
     gttttagagg gcgactggga catgggcatc gccgccgaca tcgtgcgcgc ttgggactac       420
     ctggacgtga tcgtcttggc gagcggcgac ggcgacttcg cgcccatgct cgagctcgcc       480
     cagcagcgcg gcaaacgggt cgaggtgctg gccttccgag aggccgcctc gcagaacctg       540
     ctcgacttgg cggacgcctt tatgggtttg gcggacgtgc cagacatctt tgtgtag          597
//

If you have problems or comments...

PBIL Back to PBIL home page