(data stored in ACNUC30630 zone)

EMBL: CP002049.PE336

CP002049.PE336       Location/Qualifiers
FT   CDS_pept        389576..389926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0340"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: lsp:Bsph_2646 putative HTH-type
FT                   transcriptional regulator; PFAM: helix-turn-helix HxlR
FT                   type; SPTR: A3I669 Putative uncharacterized protein; PFAM:
FT                   HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13479"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI9"
FT                   /protein_id="ADI13479.1"
FT                   /translation="MARSLIKDKYHCAMEVTLELIGGKWKPLLLYYLFGGTRRFGELKR
FT                   LLPDVTQRMLTRQLRELEGAGLVHREVFKEVPPRVEYSLTELGWSLKPLIEGMDAWGEV
FT                   YVTKIVSQSNVE"
     gtggcaaggt cgttgataaa agataagtat cactgcgcga tggaggtcac gctcgagctc        60
     atcggcggga agtggaaacc gctgcttctc tactacctgt tcgggggtac acggcggttc       120
     ggagaactca agcgcctctt gcccgatgtt actcagcgga tgcttacccg ccaattgcgc       180
     gaactggagg gggccgggct cgttcaccgg gaggtgttca aggaggtgcc gccgcgcgtc       240
     gagtattccc ttacagagct gggctggagc ctaaagccgc tcatcgaggg gatggatgcc       300
     tggggcgagg tttacgtcac caaaatcgtg tcccaaagca atgtagagta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page