(data stored in ACNUC30630 zone)

EMBL: CP002049.PE337

CP002049.PE337       Location/Qualifiers
FT   CDS_pept        complement(390380..391810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0341"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog);
FT                   InterProIPR017958:IPR006075:IPR006107:IPR018027:IPR
FT                   003789:IPR004413; KEGG: dge:Dgeo_0414
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B; PFAM:
FT                   GatB region; GatB central domain protein; Asn/Gln
FT                   amidotransferase; SPTR: C1XTX1
FT                   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;
FT                   TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B subunit;
FT                   PFAM: GatB/GatE catalytic domain; GatB domain; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13480"
FT                   /db_xref="GOA:D7CRJ0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ0"
FT                   /protein_id="ADI13480.1"
FT                   /translation="MFEPVIGLEVHLALKTRTKLFCACAAETFGSPPNTHTCPVCLGLP
FT                   GSLPTVNREAVQKTLTFALALGCEIPAVTQFHRKNYFYPDAPKNYQISQYDHPFGERGA
FT                   LELPSGRRVGITRCHLEEDAGRLQHPVYADYSLVDLNRAGAPLIEMVTEPDLRTPEEAR
FT                   EFLVRVRALARALEVSDANPEEGKMRADVNVSVRRPGEAFGTKVEVKNLNSFRSVQRAL
FT                   EFEIKRQSRILEDGGDVHQATLGWDEGGQKTYLMRTKEEEADYRYFPEPDLPPIHLTKG
FT                   WLDAVRAAMPELPAAKEARYTALGVRPDDAATLAYDRELARFFDAALAAYNGPVQTLAN
FT                   WLLSEVTGHLNAQKGTLETAKLTPQGLTALIALVDAGTISGKIAKDLLPEVIAGADPEA
FT                   LVEERGLTQLSDSAALEVLVDEVMAQNPKVVAQARENPKAINALLGRVMGASKGTANPE
FT                   RVRSLLEGKLKANASVPK"
     atgttcgaac ccgtcatcgg cctcgaggtg cacttggcgc ttaaaacccg caccaagctc        60
     ttttgcgcgt gcgccgccga gaccttcggc agccccccta acacccacac ctgcccggtc       120
     tgtttagggc tccccggcag cctcccgacc gtaaaccgcg aagccgtcca gaaaacgctc       180
     accttcgccc tcgcgctcgg ctgcgagatc ccggccgtca cgcagtttca ccgcaaaaac       240
     tacttctacc ccgacgcgcc gaaaaactac cagatcagcc agtacgacca ccccttcggc       300
     gaacgggggg cgctcgagct cccaagcggg cggcgcgtcg gtatcacccg ctgccacctc       360
     gaagaggacg ccggccgctt gcagcacccc gtctacgccg actacagcct cgtcgacctc       420
     aaccgtgcgg gcgctccctt gatcgagatg gtcaccgaac ccgacttaag gacccccgaa       480
     gaggcgcgcg agtttctggt gcgggtgcgc gccctcgcgc gcgccctgga ggtttccgac       540
     gccaaccccg aagagggcaa gatgcgcgcg gatgtcaacg tctccgtgcg gcgccccggc       600
     gaagcgttcg gcaccaaagt cgaggtcaaa aacctcaact cgtttcgcag cgtgcagcgc       660
     gcgctcgagt ttgagatcaa acgtcagagc cgcatcctag aggatggcgg cgacgtccac       720
     caggccaccc tcggttggga cgaagggggg cagaagacct acctgatgcg gaccaaagag       780
     gaagaggccg actaccgcta cttccccgaa cccgacctgc cccctattca cctcaccaaa       840
     ggctggctcg acgccgtgcg cgcggcgatg ccggagcttc ccgccgccaa ggaggcgcgt       900
     tacaccgccc tcggcgtccg gcccgacgac gcggcgacgc tcgcttacga ccgcgagctc       960
     gcacgctttt tcgacgccgc cctcgcggcg tacaacggcc cggtacagac gctcgccaac      1020
     tggctcctca gcgaggtcac gggccacctc aacgcgcaga aggggacgct ggagacggca      1080
     aaactcacgc cgcaggggct caccgccctg atcgccctgg tcgacgcggg gaccatctcg      1140
     ggaaagatcg ccaaagacct cctgcccgaa gtgatcgccg gcgccgaccc cgaggcgttg      1200
     gtcgaggaac gcgggcttac gcagctcagc gacagcgccg ccttggaggt cctcgtcgac      1260
     gaggtcatgg cgcaaaaccc caaggtcgtg gcgcaagcgc gggagaaccc aaaggccatc      1320
     aacgcgcttc taggccgcgt gatgggggcg agcaagggga ccgccaaccc ggagcgggtg      1380
     cgctctcttt tggaggggaa gctaaaggcc aatgcgagcg tgccgaagta g               1431
//

If you have problems or comments...

PBIL Back to PBIL home page