(data stored in ACNUC30630 zone)

EMBL: CP002049.PE34

CP002049.PE34        Location/Qualifiers
FT   CDS_pept        35882..36205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0034"
FT                   /product="protein of unknown function DUF59"
FT                   /note="COGs: COG2151 metal-sulfur cluster biosynthetic
FT                   protein; InterPro IPR002744; KEGG: ddr:Deide_11230
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF59; SPTR: C1XNG6 Predicted metal-sulfur cluster
FT                   biosynthetic enzyme; PFAM: Domain of unknown function
FT                   DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13177"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWT6"
FT                   /protein_id="ADI13177.1"
FT                   /translation="MSELPSKEALLEALKVVKDPEIPVNVVDLGLIYRLEVKEGGEVDI
FT                   DMTLTSMGCPVQDMIQADAELACVQVEGVKKVNVEFVWSPPWSPAKMSEDGKKQMRMFG
FT                   FNF"
     atgagcgaac tgccgagcaa agaggcgctc ctcgaggcgc tcaaggtcgt caaagacccc        60
     gagatcccgg tgaacgtcgt cgacctgggg ctcatctacc gcctcgaggt caaagagggt       120
     ggcgaggtcg acatcgacat gaccctgacc agcatgggct gccccgttca ggacatgatc       180
     caagcggacg cggagctggc ctgcgtgcag gtcgaggggg ttaaaaaggt caacgtcgag       240
     ttcgtctggt cccccccctg gtcgcccgcg aagatgtccg aggacggcaa aaagcagatg       300
     cgcatgtttg gctttaactt ctag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page