(data stored in ACNUC30630 zone)

EMBL: CP002049.PE351

CP002049.PE351       Location/Qualifiers
FT   CDS_pept        402203..402562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0355"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="InterPro IPR014314; KEGG: dge:Dgeo_0889 succinate
FT                   dehydrogenase, cytochrome b subunit; SPTR: C1XVW6 Succinate
FT                   dehydrogenase subunit C; TIGRFAM: succinate dehydrogenase,
FT                   cytochrome b556 subunit; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit;
FT                   TIGRFAM: succinate dehydrogenase, cytochrome b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13494"
FT                   /db_xref="GOA:D7CRK4"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK4"
FT                   /protein_id="ADI13494.1"
FT                   /translation="MYRGREGQWAFILHRLSGLAVFFYLMIHVVNISLASFGPQVSGPV
FT                   LSFFHQGVFRIGLVLVMAGVVYHAFNGLRIILMDFTTWGTKYHRQLWYGVLAATVAIGI
FT                   PVLWVVVPQIVADLS"
     atgtataggg gaagagaagg gcagtgggcg tttatcctgc accgcttgtc cgggttagcc        60
     gtcttctttt acctcatgat ccacgtggtg aatatcagcc tggcgagctt tgggccgcag       120
     gtctccggac ccgtgctgtc gtttttccac cagggggtct ttcgcatcgg gctggtgctc       180
     gtgatggccg gggtggtcta ccacgccttt aacgggttgc gcattatctt gatggacttt       240
     accacctggg gcacgaagta ccaccgccag ctctggtacg gcgtgttggc ggcgaccgtg       300
     gcgatcggca tcccggtgtt gtgggttgtc gtcccgcaga tcgtggcgga cctctcctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page