(data stored in ACNUC30630 zone)

EMBL: CP002049.PE356

CP002049.PE356       Location/Qualifiers
FT   CDS_pept        complement(407616..408104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol-like protein ENS-3; SPTR: C1XP23 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13499"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK9"
FT                   /protein_id="ADI13499.1"
FT                   /translation="MVQFIEEGVRQSVITFPTRDGRTLIIGYGEGFETATFDLQVTDFQ
FT                   ADELDTSLLLDYVNPFPSCGSPPAPGAKFARIVGWEREDRNEDGYLDLVINVSTLSVEV
FT                   FPCDATQAFYKATLQPHNVEQVVFLFDGQAFTATPEAERLKAFSQAPQGATRQLPFKP"
     atggttcagt ttatagagga aggtgtacgc cagagcgtta ttacctttcc tactagggac        60
     ggtcggacct tgatcatcgg ctacggagag ggcttcgaga ccgccacctt cgaccttcag       120
     gtaactgact ttcaagcgga cgagcttgat acctccttgc tgctcgacta tgtaaaccct       180
     tttccctcgt gcggtagccc gccagcgccg ggtgccaagt tcgctcggat cgtcggctgg       240
     gaaagggaag atcgaaatga ggacggttac ctcgatctcg ttataaacgt gtctacgctg       300
     agcgttgagg tatttccttg cgacgcaacc caggcatttt ataaggcgac cttgcaaccg       360
     cacaatgtcg agcaggtcgt ctttctcttc gacggccagg cgttcacggc tacaccggaa       420
     gcggagcgcc tcaaggcgtt ctcgcaagcg ccacaggggg ctacgcggca gctgcccttt       480
     aaaccttaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page