(data stored in ACNUC30630 zone)

EMBL: CP002049.PE372

CP002049.PE372       Location/Qualifiers
FT   CDS_pept        complement(421905..423953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0376"
FT                   /product="cobyric acid synthase CobQ"
FT                   /EC_number="2.7.7.62"
FT                   /note="COGs: COG1492 Cobyric acid synthase;
FT                   InterProIPR002586:IPR011698:IPR003203:IPR017929:IPR 004459;
FT                   KEGG: dge:Dgeo_2874 cobyric acid synthase CobQ; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; cobalbumin biosynthesis
FT                   protein; PRIAM: Adenosylcobinamide-phosphate
FT                   guanylyltransferase; SPTR: Q1J2I1 Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobinamide
FT                   kinase / cobinamide phosphate guanyltransferase;
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13515"
FT                   /db_xref="GOA:D7CRM5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM5"
FT                   /protein_id="ADI13515.1"
FT                   /translation="MVQGCSSGAGKSYLTAALCRLYARRGVRVAPFKAQNMSNNAGVTP
FT                   DGLEMSRAQLVQARAARVVPDVRMNPVLLKPEGDRRSQVVLLGRADPALSRLPWEARKA
FT                   RLWPHVAASLRGLLEAFELVILEGAGSPAEVNLKAGDIVNMRAALEADAKVLLVADIDR
FT                   GGAFAHLLGTWACLEAAERETLLGFVLNKFRGDPALLGDATAWLAARTGRPTLGVVPYL
FT                   PLALPEEDAQDLPPAGAAAREAPVRVAALRFPTVSNFDEFGPLARHPAVALSWVEAPSA
FT                   LAAADLIVLPGSKHLTTDAAWLQRTGLGAAVQERAESGALVLGICGGMQLLGRVIHDPH
FT                   GLEGAAGTVTGLGLLDLETTLAPIKVTRNVQSTLLATGETVTGYEIHHGRTRAGGRAQP
FT                   LLADGLGFRQGRVLGVYPHGLLEDAAFVRYLLGALGVSAAQLDPEAGLEAALDRLADHV
FT                   EAHLDVSAIDDALFRGRAPRRPPRLVLVTGGARSGKSRYAEALVRRFLEPGEGALYLAT
FT                   LRASDPEMARRVARHRARRPVSWRTLETPLAPAEALAAAPERVVLLDCLSGYVANLLLS
FT                   RYAAGEQSEAEAAAQAGDEAIAAALAGVDALLGAVRRAGKTVVVVTNEVGSGVVPAYAL
FT                   GRLFRDALGLANARVAAAADAVALCVVGLPQLLKGTLPEVTLDEGDA"
     atggtgcagg ggtgcagcag cggcgcgggc aagtcgtacc tgacagccgc cctctgccgc        60
     ctctacgcgc ggcgcggcgt gcgggtcgcc cccttcaaag cgcagaacat gagcaacaac       120
     gccggcgtca cgcccgacgg gctcgagatg agccgcgcgc agctcgtgca ggcccgcgcc       180
     gctcgcgtcg tccccgacgt gcggatgaac ccggtgctgc tcaaacccga aggcgaccgg       240
     cgctcgcagg tcgtgctcct cggccgcgcc gacccggcgc tctcacggct cccctgggag       300
     gcgcgcaagg cgcgcctctg gccgcacgtg gcggcgtcgt tgcggggcct tctggaggcg       360
     ttcgagctgg tcatcttgga gggcgcgggc agccccgccg aggtcaactt gaaagcgggc       420
     gacatcgtca acatgcgcgc cgcgctcgag gccgacgcga aggtgctcct cgtcgccgac       480
     atcgaccgcg ggggggcgtt cgcccacctc ttgggcacct gggcgtgctt ggaggcggcc       540
     gaacgggaga cgctcctcgg tttcgtgctc aacaagttcc gcggcgaccc cgccctcttg       600
     ggggacgcca cggcgtggtt agcggcgcgc acggggcggc cgactttggg ggtggtgccc       660
     tatctgccgc tcgcgctccc cgaggaggac gcgcaggacc tgccgccggc gggggcggcc       720
     gcgcgcgagg cgcccgtccg ggtggccgct ctgcgctttc cgacggtctc caacttcgac       780
     gagttcggcc ccctcgcgcg gcacccggcg gtggcgctca gctgggtcga ggcgccgagc       840
     gcgctggccg cggccgacct catcgtgctg cccggctcga agcacctcac cacggacgcc       900
     gcttggctgc aacgcaccgg cctcggggcg gcggtgcagg agcgcgcgga gagcggcgcg       960
     ctggtgctcg ggatctgcgg tgggatgcag ctcttgggcc gcgtcatcca cgacccccac      1020
     gggctcgagg gggcagcggg gacggttacg gggttggggc ttttggacct ggagaccacc      1080
     ctggcgccca ttaaggtcac gcgaaacgtc caaagtaccc tgttggcgac gggcgaaacg      1140
     gtcaccggct acgagattca ccacggccgc acccgcgccg ggggccgcgc gcaacccctc      1200
     cttgccgacg gcctcgggtt tcggcagggg cgcgtcctgg gcgtctatcc gcacgggctc      1260
     ttggaggacg cggcgttcgt ccgctacctg ctcggcgcgc tcggcgtgag cgcggcacag      1320
     ctagaccccg aggcggggct cgaggcggcg ctcgaccggc tcgccgacca cgtcgaggcg      1380
     cacttagacg tcagcgccat cgacgacgcc ctctttcgcg ggcgcgcccc gcggcgcccc      1440
     ccgcggctcg tgctggtcac cggcggggcg cgctcgggca agtcgcgcta cgccgaggcg      1500
     ctcgtgcggc gctttttgga gccgggcgag ggggcgctct acctggcgac gttgcgcgcg      1560
     agcgacccgg agatggcgcg gcgcgtcgcg cggcaccgcg cgcggcgacc cgtgagctgg      1620
     cggacgctcg agaccccgct cgccccggcc gaggcgctcg cggcggcccc cgagcgggtg      1680
     gtgctgctcg actgcctgtc gggctacgtc gcgaacctgc tccttagccg ctacgctgcg      1740
     ggcgaacaga gcgaagcgga ggccgccgcg caggccggcg acgaggccat cgcggcggcc      1800
     ttggcggggg tcgacgcgct tttgggggcg gttcgccgcg cgggcaaaac cgtcgtggtg      1860
     gtgaccaacg aggtcggtag cggggtggtg cccgcctacg cgctcggtcg ccttttccgc      1920
     gacgcgctgg gcctcgccaa cgcccgcgtc gccgcggctg ccgacgccgt ggcgctctgc      1980
     gtggtggggc tgccgcagct cctcaagggc accctgccgg aggtgacgct cgatgagggg      2040
     gacgcgtga                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page