(data stored in ACNUC30630 zone)

EMBL: CP002049.PE38

CP002049.PE38        Location/Qualifiers
FT   CDS_pept        41250..41918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0038"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="COGs: COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains); InterPro
FT                   IPR001451:IPR011004:IPR018357; KEGG: dtu:Dtur_1633
FT                   transferase hexapeptide repeat containing protein; SPTR:
FT                   B8E332 Transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13181"
FT                   /db_xref="GOA:D7CWU0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWU0"
FT                   /protein_id="ADI13181.1"
FT                   /translation="MLTCYDLFDLSRVSPNLRPLLEVTRPWEVLAKLDAFCTEIPDQRL
FT                   GEVHPTAVLVGNVYLEAGAKVGPHALIEGPAWIAAGAEVGHGAYLRGGVVLAAGAKVGH
FT                   ATEVKRALFLEGAKAPHFNYVGDTVLGRGVNLGAGVKLANLKTFGDTIEVAGESTGLRK
FT                   FGAALGDGVSIGCNAVTAPGTIVGPRTIIYHGATVRGVVPADVVVKLKQPLQTVPRRDP
FT                   "
     atgctgacct gctatgacct cttcgacctc tcgcgcgtct caccgaactt gcggcccctg        60
     ctcgaggtaa cgcgcccctg ggaggtgctc gccaagctcg acgccttttg taccgagatc       120
     cccgaccagc gcctcggcga ggtgcacccg acggcggtgc tcgtcggcaa cgtgtacctc       180
     gaagcggggg cgaaggtcgg accccacgcc ctgatcgagg gcccagcgtg gatcgccgcg       240
     ggcgccgagg tcgggcacgg cgcctacctc cgcggggggg tggtcctggc ggcaggggcg       300
     aaggtcggtc acgccaccga ggtcaaacgc gcgctctttt tggagggggc caaagcgccg       360
     cacttcaact acgtcggcga caccgtgctc ggccgcgggg tcaacttggg cgcgggggtc       420
     aagctcgcca acctcaagac cttcggcgac accatcgagg tcgcggggga gagcacgggg       480
     ctgcgcaagt tcggcgccgc cctgggcgat ggggtgtcga tcggctgcaa cgcggtgacc       540
     gccccgggga ccatcgtcgg gccgcggacg atcatctatc acggggcaac ggtgcgcggt       600
     gtggtaccgg ccgacgtcgt cgtcaagctc aagcagccgc ttcagacggt accgcgccgc       660
     gacccttag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page