(data stored in ACNUC30630 zone)

EMBL: CP002049.PE4

CP002049.PE4         Location/Qualifiers
FT   CDS_pept        4389..5840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0004"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase;
FT                   InterProIPR001697:IPR015793:IPR015794:IPR015813:IPR
FT                   015795:IPR011037:IPR018209; KEGG: ddr:Deide_00040 putative
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PRIAM: Pyruvate kinase; SPTR: C1CXJ4
FT                   Pyruvate kinase; TIGRFAM: pyruvate kinase; PFAM: Pyruvate
FT                   kinase, barrel domain; Pyruvate kinase, alpha/beta domain;
FT                   TIGRFAM: pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13147"
FT                   /db_xref="GOA:D7CWQ6"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ6"
FT                   /protein_id="ADI13147.1"
FT                   /translation="MRQVRRTKIVATLGPASSDPEVIKNLIQAGVNVFRLNFSHGSRET
FT                   HQNNIALIRQEAARLGTPIGVLQDLQGPKIRTTTFAEGKVMLTAGQRFNLTCDDTSPGD
FT                   AARVGVTYPNLFADVKVGDTLLLDDGRLALRVTAVRGETIETEVTLGGVLSNNKGINIP
FT                   DADLSIPALTDKDVEDLLFGAELDVDWVAMSFVRSRDDLLLARHYLARAGSRAKLMAKI
FT                   EKPSAVARFDEILAEVDGIMVARGDLGVELPPERVPIIQKRLIRACVEAGKPVVTATQM
FT                   LESMISSPTPTRAEASDVANAIYDGTDAIMLSAETAVGSYPVEAVRMMARIALSVEGDA
FT                   SYQANLREHYPQPDSTTADAVSLAACQMAHFLSARMIVTFTSSGTTALRVAHNRPSAPI
FT                   LALTPSERAYRQLSLSWGILPVFSEEIHSTDEMVEVANAKIIELMKRTAGLTVGDRYVI
FT                   TAGVPFGMRGTTNLIRVEVIRETPG"
     atgcgccagg ttcgccgaac caagatcgtc gccaccttgg ggccggcgag cagcgacccc        60
     gaggtcatca aaaacctcat ccaggcgggg gtcaacgtct ttcggcttaa cttctcgcac       120
     ggcagccgcg agacgcacca aaacaacatc gcactgatcc ggcaggaggc ggcgcgactc       180
     ggcaccccca tcggcgtgct gcaagacctt caaggcccga agatccgcac caccaccttt       240
     gccgagggca aggtcatgct gaccgccggg cagcgtttta acctgacctg tgacgacacc       300
     tcccccgggg acgctgcgcg cgtgggcgtc acctacccca acctgtttgc cgacgtcaag       360
     gtcggcgaca cgctgctttt agacgacggg cggctcgcgc tgcgcgtcac ggcggtgcgc       420
     ggcgagacca tcgagaccga ggtcaccctc gggggggtgc tctcgaacaa caaggggatc       480
     aacatccctg acgctgacct gtcgatcccc gcgctgaccg acaaggacgt cgaggacctg       540
     ctctttggag cggagctcga cgtcgactgg gtggcgatga gcttcgtgcg gagccgcgac       600
     gacctgctgc tcgctcggca ctacctcgcg agggcagggt cgcgggcgaa gctgatggcc       660
     aagattgaaa agccgtcggc ggtcgcccgc ttcgacgaga tcctcgccga ggtcgacggc       720
     atcatggtcg cgcgcggcga tctgggggtc gagctccccc ccgagcgggt accgatcatt       780
     caaaagcgcc tgatccgcgc ctgcgtcgag gcgggcaaac cggtcgtgac cgcgacgcag       840
     atgctcgaga gcatgatctc gagcccgacg ccgacgcgcg cggaggcctc cgacgtggcc       900
     aacgccatct acgacggcac cgacgccatt atgctctcgg ccgagacggc ggtcgggagc       960
     tatccggtcg aagcggtgcg gatgatggcc cgcatcgccc tatcggtcga gggggacgcg      1020
     agctaccagg ccaacttgcg cgagcactac ccgcaacccg acagcaccac ggccgatgcg      1080
     gtgtcgctcg ccgcctgcca gatggcgcac tttctctccg ccaggatgat cgtgaccttt      1140
     acctcgtcgg ggacgacggc gctgcgcgtg gcgcacaacc gcccctcggc gcccatcttg      1200
     gcgctgaccc cgagcgagcg ggcctaccgg cagctcagcc tctcgtgggg gatcctgccg      1260
     gtattctccg aagagatcca ttcgaccgac gagatggtcg aggtcgccaa cgccaagatc      1320
     atcgagctga tgaagcgcac ggcgggtctt accgtcggcg accgctacgt gatcaccgca      1380
     ggcgtccctt tcggtatgcg cggcaccacc aacctcatcc gtgtcgaggt gatccgcgaa      1440
     acccccggat ag                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page