(data stored in ACNUC30630 zone)

EMBL: CP002049.PE400

CP002049.PE400       Location/Qualifiers
FT   CDS_pept        453767..454861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0405"
FT                   /product="peptidase M50"
FT                   /note="COGs: COG0750 membrane-associated Zn-dependent
FT                   protease 1; InterPro IPR008915:IPR001478; KEGG:
FT                   ddr:Deide_13240 putative membrane-associated zinc
FT                   metalloproteases; putative membrane protein; PFAM:
FT                   peptidase M50; SMART: PDZ/DHR/GLGF domain protein; SPTR:
FT                   C1XT39 RIP metalloprotease RseP; PFAM: Peptidase family
FT                   M50; PDZ domain (Also known as DHR or GLGF); TIGRFAM: RIP
FT                   metalloprotease RseP"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13543"
FT                   /db_xref="GOA:D7CRQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ3"
FT                   /protein_id="ADI13543.1"
FT                   /translation="MLTAVVFLLVLTVSVVVHELAHYLNARMVGVPVRAFSVGMGPVLL
FT                   RKRWRGTEWRLSLLPLGGYVDLKGLAPEQAEDGTLRYPDEGFMQKSFLQKTWVLVGGVI
FT                   ANFILAVLLLATVMTVEPNTAVRSLITGEVPSESGTVFQEVLPGTPAEALGIEPGDRVL
FT                   SFNGVADPSRSEVQRLTRTATSLEIVLERGGERLTVRSDWPPPDAGDPPRLGVTLAPVE
FT                   ISPLPPLSFPEAAWRSASFFVRIVPESVAGFARGFGQTFAGQRSAEIVGPVGIVGIAGE
FT                   AARGGLVAVLTFAGLINFSLALFNALPIPGLDGGRILLAAVVALRGKPFKPGQEEFVNF
FT                   LGLAFLVLFVVLISFGEVGDLFRR"
     gtgctaaccg ccgtcgtctt cttgctggtg ttgaccgttt cggtcgtggt gcacgagctc        60
     gctcactacc tcaacgcccg catggtcggc gtgccggtgc gcgcctttag cgtcgggatg       120
     ggacccgttt tgctgcgcaa gcgctggcgc ggtaccgagt ggcgcctgtc gctgctgcct       180
     ttgggggggt acgtcgacct caaagggctc gcccccgagc aggccgagga cggcaccctg       240
     cgctaccccg acgaggggtt tatgcagaag agttttctgc aaaagacgtg ggtgctggtg       300
     ggtggggtga tcgccaactt tatcctcgcg gtgctgctgc tcgcgaccgt gatgaccgtt       360
     gaacccaaca cggcggtgcg cagcctcatc acgggggagg tgccgagcga gtcggggacg       420
     gtgtttcagg aggtcctccc gggcaccccc gccgaagcgt tggggatcga gcccggcgac       480
     cgcgtgctgt cgtttaacgg cgtcgccgac ccgagccgca gcgaggtgca gcggctgacg       540
     cgcacggcga cctcgttgga gatcgtcctg gagcgcggcg gtgagcgcct gacggtgcgc       600
     agcgactggc ccccgccgga cgccggcgac ccgccgcggc tcggggtgac gctggccccc       660
     gtcgagatca gcccgctccc ccccctgtcg ttccccgaag cggcctggcg gagcgcgagc       720
     tttttcgtcc gcatcgtccc ggagtcggtg gctgggtttg cgcgcggttt cgggcagacc       780
     ttcgcggggc agcgcagcgc ggagatcgtc ggcccggtcg gcatcgtcgg tatcgcgggg       840
     gaggcggcgc ggggcggcct agtggcggtg ctcacctttg ccgggttgat caacttctcc       900
     ctggcgctct ttaacgccct accgatcccc ggtctcgacg gggggcgtat cctcctggcg       960
     gcggtcgtgg cgctccgcgg caaaccgttt aaaccggggc aagaggagtt cgtcaacttt      1020
     ttggggctgg cgtttttggt gctcttcgtc gtgctcatct cgtttggcga ggtcggtgac      1080
     ctctttcggc gctaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page