(data stored in ACNUC30630 zone)

EMBL: CP002049.PE407

CP002049.PE407       Location/Qualifiers
FT   CDS_pept        complement(460422..460880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0412"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="COGs: COG3088 Uncharacterized protein involved in
FT                   biosynthesis of c-type cytochromes; InterPro IPR005616;
FT                   KEGG: ttj:TTHA1402 cytochrome c-type biogenesis protein;
FT                   PFAM: cytochrome C biogenesis protein; SPTR: Q5SIG7
FT                   Cytochrome c-type biogenesis protein; PFAM: Cytochrome C
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13550"
FT                   /db_xref="GOA:D7CRR0"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR0"
FT                   /protein_id="ADI13550.1"
FT                   /translation="MRRTLLLILSLLGAAFAQHVELEQEVFAIARELRCPVCRAESAAD
FT                   SNATTSVEFRGIIRELLAEGHSREEILAYFTARYGDWILLEPPRRGIHLVVWVLPILAV
FT                   LAGVTLLALLVRRWTRAAAAPIEVDAEGLERVQRELTAGPEHAPEGAP"
     atgcgacgca ccctgctact aatccttagc cttctcggcg cggcttttgc ccagcacgtc        60
     gagctcgagc aggaagtctt tgccatcgcc cgcgagctgc gctgtccggt ctgccgcgcg       120
     gagtcggccg ccgactcgaa cgccaccacc agcgtcgaat tccgcggcat catccgcgag       180
     ctcctcgccg aaggccacag ccgcgaggag atcttggcct actttacggc gcgctacggc       240
     gactggatcc tgctcgagcc cccccgccgc ggcatccacc tcgtcgtttg ggtgttgccg       300
     atcctcgccg tgctcgccgg cgtgaccctg ttggcgctcc tcgtgcggcg ttggacgcgc       360
     gccgccgccg cccccatcga ggtcgacgcc gaagggcttg agcgcgtgca gcgcgaactc       420
     accgctggcc ccgagcacgc ccccgaagga gccccgtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page