(data stored in ACNUC30630 zone)

EMBL: CP002049.PE412

CP002049.PE412       Location/Qualifiers
FT   CDS_pept        complement(464046..464804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0417"
FT                   /product="cytochrome c assembly protein"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003557:IPR002541; KEGG: tth:TTC1041 heme exporter
FT                   protein C; PFAM: cytochrome c assembly protein; SPTR:
FT                   B7A5K7 Cytochrome c assembly protein; PFAM: Cytochrome C
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13555"
FT                   /db_xref="GOA:D7CRR5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR5"
FT                   /protein_id="ADI13555.1"
FT                   /translation="MTRPVASTPRRAPRVPPRPKWLNLLGLAALALFGVGLYLALVTSP
FT                   ADINQGDLIRVMYAHVSVAWICFLAVFLTALFGSLFLWSGRRSFDVWALANAELALVFA
FT                   ALTLVGGMTYSRPTLNTWWTWDAKLTLTALLFALLVGYFIVRGMLEDPDRRGRVSAVVS
FT                   IIAAASLPFNYFAANWFRTLHPAKSIRLDGGGVTMDGSMLQALLVNVAAAALIYLFFMV
FT                   ERARVGRLEAQLETEREKTLQSAPQEVIHV"
     atgacccgac ccgtcgcttc cacgcctcga cgcgcccccc gcgtgccgcc gcgccccaag        60
     tggcttaacc tcctcgggct cgccgcgctg gcgctctttg gcgtcggcct ctacctggcg       120
     ctcgtcacct cccccgccga catcaaccaa ggcgacctca tccgggtgat gtacgcccac       180
     gtctcggtcg cctggatctg ctttttggcg gtctttttaa cggcgctttt cggttccctc       240
     tttctctgga gcggccgccg cagcttcgac gtctgggcgc tcgccaacgc cgagttggcg       300
     ctcgtctttg cggccctgac gctagtcggt gggatgacct acagccgccc gacgctgaac       360
     acctggtgga cctgggacgc caagctgacc ctcacggcgc tcctgttcgc ccttttggtc       420
     ggctatttca tcgtccgcgg tatgctcgag gaccccgacc ggcgcggccg cgtcagcgcg       480
     gtggtcagca tcatcgcggc ggcgagcttg ccctttaact atttcgcggc caactggttt       540
     cgcaccctgc accccgccaa gagcatccgt ttagatggcg gcggcgtgac gatggacggt       600
     tcgatgctcc aggcgctcct cgtcaacgtc gcggcagcgg cccttatcta cctctttttc       660
     atggtggagc gcgcccgcgt cgggcgccta gaggcgcagc tcgagaccga acgcgaaaag       720
     acgctgcaga gcgcgccgca ggaggttatc catgtttga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page