(data stored in ACNUC30630 zone)

EMBL: CP002049.PE414

CP002049.PE414       Location/Qualifiers
FT   CDS_pept        complement(465544..466236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0419"
FT                   /product="heme exporter protein CcmA"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR005895:IPR003593; KEGG: dra:DR_0406
FT                   ABC transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q9RXA9 ABC transporter,
FT                   ATP-binding protein; TIGRFAM: heme exporter protein CcmA;
FT                   PFAM: ABC transporter; TIGRFAM: heme ABC exporter,
FT                   ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13557"
FT                   /db_xref="GOA:D7CRR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRR7"
FT                   /protein_id="ADI13557.1"
FT                   /translation="MSTVPAVALTNLGRRYGASFVLRGVNLQVAPGRTVVLKGGNGAGK
FT                   TTLLRVLSTRLRPSLGSGRVFGFDLVKQGHAVRERVAYLSVFGGSYGGLTPLENLALAA
FT                   QLYNRAPAPGELAALLERVGLGGAQHKLVRSFSSGMKKRLGLARLLLSEADLWLLDEPY
FT                   AALDEAGKGLVDGLVLEAKAQGKTVLMASHDLERSAPLADSVLELRDGALSVVFTGDAA
FT                   KTRGAAHG"
     gtgagcacgg tgcccgcggt tgcgctcacc aacctcggac ggcgctacgg cgcgtcgttc        60
     gtgctgcggg gcgtcaattt gcaggtcgcg ccggggcgca ccgtggtctt aaaggggggc       120
     aacggcgcgg gtaagacgac gctcttgcgc gtgctctcga cgcggctgcg gccgagcttg       180
     gggagcgggc gggtcttcgg cttcgacctc gtcaaacagg ggcacgcggt gcgcgagcgc       240
     gtggcctacc tgagcgtctt cggcggctcc tacggggggt tgacgccgct agagaacctc       300
     gcgctcgccg cgcagctcta caaccgagcg cccgccccgg gggagctcgc agcgcttttg       360
     gagcgcgtcg gcctcggcgg ggcgcagcac aagctggtgc gcagcttttc gagcgggatg       420
     aaaaagcgcc tcgggctcgc gcggctgctg ctctcagagg ccgacttgtg gcttttggat       480
     gagccttatg cggccctcga cgaagcgggc aaggggctcg tcgacggcct cgtgctcgag       540
     gccaaagcgc agggcaaaac cgtcctgatg gcctcacacg acctggagcg gagcgcgccc       600
     ctggccgaca gcgtgctcga gctgcgggat ggcgccctga gcgtggtctt tacgggtgac       660
     gcggcaaaga cccggggagc ggcgcatggt taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page