(data stored in ACNUC30630 zone)

EMBL: CP002049.PE421

CP002049.PE421       Location/Qualifiers
FT   CDS_pept        complement(470251..470493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0427"
FT                   /product="Domain of unknown function DUF1902"
FT                   /note="InterPro IPR015066; KEGG: ttj:TTHA1013 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1902; SPTR:
FT                   A0ZK26 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF1902)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13564"
FT                   /db_xref="InterPro:IPR015066"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS32"
FT                   /protein_id="ADI13564.1"
FT                   /translation="MVADRAIEVHAFWDEEAGVWVAESDHVPGLVTEAETVEQLAAKLE
FT                   HLIPELLELNAPELLGAPTVNLKAERTLVRAPARP"
     atggttgcgg atcgggcgat agaggtacac gctttctggg atgaagaggc gggcgtatgg        60
     gtggcagaga gcgaccatgt acccggcctt gtgactgaag ccgaaaccgt ggagcagcta       120
     gctgccaagc tcgagcacct tatccccgaa ctcttggagc tgaacgcgcc tgagcttctg       180
     ggcgccccca cggtcaacct gaaggctgag cgcaccctag tacgggcacc agcccggccc       240
     tag                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page