(data stored in ACNUC30630 zone)

EMBL: CP002049.PE422

CP002049.PE422       Location/Qualifiers
FT   CDS_pept        complement(471667..471936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0428"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="COGs: COG1343 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR003799; KEGG:
FT                   tth:TT_P0101 hypothetical protein; PFAM: protein of unknown
FT                   function DUF196; SPTR: C1XW87 CRISPR-associated protein
FT                   Cas2; TIGRFAM: CRISPR-associated protein Cas2; PFAM: CRISPR
FT                   associated protein Cas2; TIGRFAM: CRISPR-associated protein
FT                   Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13565"
FT                   /db_xref="GOA:D7CS33"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS33"
FT                   /protein_id="ADI13565.1"
FT                   /translation="MAGLYTVSYDIPNDNRRVKLANVLKSFGERVQYSVFECWLEPREL
FT                   RELRQKLEARLNEREDSVRIYPVGSPVEVLGSGSPTEDARLFMF"
     atggccggac tctacaccgt ctcgtacgac atccccaacg acaaccggcg cgtcaagctc        60
     gccaacgtgc ttaaaagctt cggcgaacgg gtgcagtatt cggttttcga gtgctggctc       120
     gagccgcgcg agctgcggga gctgcgccaa aagctcgagg cgcgcctcaa cgaacgcgag       180
     gacagcgtgc gcatctaccc cgtcggttct cccgtagagg tgttggggtc aggatcgcca       240
     accgaagacg cgcgcctatt tatgttctag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page