(data stored in ACNUC30630 zone)

EMBL: CP002049.PE426

CP002049.PE426       Location/Qualifiers
FT   CDS_pept        complement(477309..478052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0432"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="COGs: COG5551 conserved hypothetical protein;
FT                   InterPro IPR019267:IPR010156; KEGG: tth:TTC1927
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2276; SPTR: B7A9Z1 CRISPR-associated protein Cas6;
FT                   TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   Uncharacterized conserved protein (DUF2276); TIGRFAM:
FT                   CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13569"
FT                   /db_xref="GOA:D7CS37"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS37"
FT                   /protein_id="ADI13569.1"
FT                   /translation="MSLVALVLPLTGAQKPEAVHVRGALYALLKEHAPELHDRQDLKPF
FT                   TVSVGGAAKDHPPFIRLTFLSEPLYTALAPALHDLPRRPLSLGDRTYTVTDVLQEGHPW
FT                   AGATTYPRLFQTPGDADLSLHFATPTVFRRHGANYPLPEPRLVLGSLIERWNLYAPLAV
FT                   PSEVASRLTEGCVPRFFELRSRTVYAHDPFTGFLGRVTFHLRGASADEAHWLAILGRFA
FT                   FYSGVGAKTTLGFGQVRPYRPTPGA"
     atgtccctcg tcgccctcgt tctcccgctc accggcgccc aaaaacccga agccgtccac        60
     gtccgcggcg ccctctacgc ccttctcaag gagcacgcgc ccgaactcca cgaccgccaa       120
     gacctcaaac cctttaccgt ctccgtaggg ggtgcggcaa aggaccaccc gccctttatc       180
     cgcctgacgt ttttgagcga acccctctac accgcgctcg cccccgccct ccacgacctc       240
     ccgcggcgcc ccctgagtct cggcgaccgc acctacaccg tcaccgacgt gctccaagag       300
     ggccaccctt gggccggagc gaccacctac ccccgcctct ttcaaacgcc cggggacgcc       360
     gacttgtcgc tgcacttcgc cacccccacg gtctttcgtc gccacggcgc caactacccg       420
     ctccccgaac cccgcctcgt gctcgggtcg ctgatcgagc gctggaacct ctacgccccc       480
     ctagcggtcc cctccgaggt cgcctcacgc ctgaccgagg ggtgcgtgcc ccgctttttt       540
     gaactgcgca gccgcaccgt ctacgcccac gaccccttta ccggctttct cggccgcgtc       600
     acctttcacc tccgcggcgc cagcgccgac gaggcccact ggctcgccat cctcggccgc       660
     ttcgccttct atagcggcgt cggcgccaag accaccctcg gcttcggcca ggtgcgcccg       720
     taccgcccca ccccaggtgc ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page