(data stored in ACNUC30630 zone)

EMBL: CP002049.PE434

CP002049.PE434       Location/Qualifiers
FT   CDS_pept        complement(484465..486687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0440"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterProIPR013105:IPR001440:IPR019734:IPR013026:IPR
FT                   011990; KEGG: cyp:PCC8801_1300 TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: B7K3M3 TPR
FT                   repeat-containing protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13577"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS45"
FT                   /protein_id="ADI13577.1"
FT                   /translation="MKRAPLLQLFALLALAAPLAWAQPPAHEGAVDRLVVLAFDADETD
FT                   SPYRLGLATGLQRALNVIDGVYAPPVGDTLLVAQRAEAQGTLDTATFAEAFGARALVSG
FT                   LVGLSGDGEGLVIDLVFAGPDDAVRRVPVSGPADNPAALLASVVEAVVTELELTLSADD
FT                   EAQVAAVVAQTPSLASLGAVGEAALGLEARDTPELQAAAERDAGSSWVLSERAEALAAA
FT                   GELEPALAASLAAIEAAPEDVEALVKRGVVLAAAGDAATAREAFAAALALNPAHAVALA
FT                   GSARFAEPEAARAALTRALKAYPRYAAAYLELAALQRRTDDAEGALITLREAVERVPES
FT                   ASLHAALIGELVRRGEGDEALAVLEARLAADPDPSAYALASALGEAQSARALEILREGR
FT                   QRYPQDAALALAEAEVLRGTGNLEAAEAVLQEALDAAPTNPELANQLAITQAQAGRTDE
FT                   ARATLEAALAQNPQARGVLERNLAQLLLEAGQNEAAIGVLEPLLARDAGDPELYTLYGL
FT                   ALGGAGRFDQALNALDEALRLAPTSQDAQNARRLVEQNQRLTGAERLAFDPDVAAVFGA
FT                   GLSALQADELAAAQREFDRAAELQADVADEAGAEAGTIAFYQGYARQLQGDLRGAVEHY
FT                   ERALEGLPESATVLNNAGFAYFRLGRFDRALDYLTRATQADPDNSEAQLNLGLVLFDLG
FT                   RFAQAVAPLERALERNPDLAELRVDPGDGEPLLLPELVDQARQSAQ"
     atgaaacgcg ctccccttct gcagcttttc gccctcctcg ccctcgcagc gccgctcgct        60
     tgggcgcaac cgcccgcgca cgagggcgcg gtcgaccgcc tcgtcgtcct cgccttcgac       120
     gccgacgaga ccgactcccc ctaccgcttg gggctcgcca ccgggcttca gcgggcgctt       180
     aacgtcatcg acggcgtcta cgcccccccc gtcggcgaca ccctgctcgt cgcgcaacgc       240
     gccgaggcgc agggcacgct cgacaccgcc accttcgccg aagccttcgg cgcccgcgcg       300
     ctcgtcagcg ggctcgtcgg cctgagcggc gacggcgagg gcctcgtcat cgacctcgtc       360
     ttcgccggcc ccgacgacgc cgtccggcgc gtccccgtca gcggaccggc tgacaacccc       420
     gccgccctgt tggcgagcgt cgtcgaggcg gtcgtcacgg agctcgagct caccctctcg       480
     gccgacgacg aagcgcaggt cgccgcggtc gtcgcgcaga ccccctcgct ggcgtcgctc       540
     ggcgcggtcg gcgaggcggc cttggggctc gaggcgcgcg acacccccga gctgcaagcg       600
     gcggccgaac gcgacgcggg ctcgagctgg gtgctctcgg agcgcgccga agctctcgcc       660
     gccgccgggg agctcgagcc ggcgctagcg gcgtcgctcg ccgctatcga ggccgccccc       720
     gaagacgtcg aggcgctcgt caaacgcggt gtggtgctcg ccgcggcggg cgacgcggcg       780
     accgcgcgcg aggccttcgc ggcggcgctc gcgctcaacc ccgcgcacgc cgtcgcgctc       840
     gccggcagcg cccgcttcgc cgaacccgaa gcggcccgag cggcgctgac gcgcgccctg       900
     aaggcgtacc cgcgctacgc ggcggcctac ttagagctcg cggcgctgca gcgccgcacg       960
     gacgacgccg agggggccct gataacgctc cgcgaggcgg tcgagcgcgt ccccgaatcg      1020
     gccagcctgc acgcggcgct gatcggcgag ctcgtgcgcc gcggcgaggg ggacgaagcg      1080
     ctcgcggtcc tcgaggcgcg cctggcagcc gaccccgacc ccagcgccta cgcgctcgcc      1140
     agcgcgctcg gcgaagcgca gagcgcgcgc gccctggaga tcctccgcga gggccgccag      1200
     cgctaccccc aagacgcggc gctcgcgctc gccgaggccg aggtgctgcg cggcacgggg      1260
     aacctcgagg cggccgaggc ggtcttgcag gaggccttgg acgccgcccc caccaacccc      1320
     gagctcgcca accagctcgc catcacccag gcgcaggcgg gcagaacgga cgaggcgcgc      1380
     gccaccctcg aggcggccct cgcgcagaac ccgcaggcca ggggggtgtt ggagcgcaac      1440
     ctcgcgcagc tgctgctcga ggcgggccag aacgaggccg ccatcggggt gctcgaaccg      1500
     cttttggcgc gcgacgcggg cgaccccgag ctctacaccc tctacggcct cgccctcggc      1560
     ggggcgggcc gcttcgacca ggcgcttaac gcgctcgacg aggcgctgcg cttagcgccg      1620
     acgtcgcaag acgcgcagaa cgcgcggcgg cttgtcgaac agaaccagcg gctcaccggc      1680
     gccgagcgcc tggcgtttga cccggacgtc gcggcggtgt tcggcgcggg cctctcggcg      1740
     ctgcaagccg atgagctggc ggcggcgcag cgcgagttcg accgcgccgc cgagctgcaa      1800
     gcggacgtcg ccgacgaagc gggcgccgaa gcggggacga tcgcctttta ccagggctac      1860
     gcgcggcagc tccaggggga tctgcgcggc gccgtcgagc actacgagcg ggcgctcgag      1920
     gggctgccgg agagcgcgac ggttctgaac aacgcgggct tcgcctactt ccgcctgggc      1980
     cgctttgacc gcgcgctcga ctacctcacg cgcgccaccc aggccgaccc cgacaacagc      2040
     gaggcgcagc tcaacctggg gctcgtgctc tttgatctcg gccgcttcgc ccaggcggtc      2100
     gccccgctcg agcgggcgct cgagcgcaac cccgacctgg ccgagctgcg cgtcgacccc      2160
     ggcgacggcg agcccctgct cctgcccgag ctcgtcgacc aggcgcggca gagcgcacag      2220
     taa                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page