(data stored in ACNUC30630 zone)

EMBL: CP002049.PE44

CP002049.PE44        Location/Qualifiers
FT   CDS_pept        45840..47465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; KEGG: ana:alr7249 hypothetical protein; SPTR:
FT                   Q8YKP4 Alr7249 protein; PFAM: Transposase domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13187"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX63"
FT                   /protein_id="ADI13187.1"
FT                   /translation="MLKPQPVPPVPEMTARAAHAAFPKGHCYLTLRDELGTIFTDDMFA
FT                   DLFPTVGRPAEAPWRLALVTIVQFAEGLSDRDVADAVRDRITLKYLLGLEYDDSGFDYS
FT                   ILSRFRDRLVEGNSVAILLDALVEASRKAGLIKHRGKVRTDATHILAKIRELSRLELVG
FT                   ETLRHALNEIAKAAPEWLRALAPDDWYKRYAKRFEEESYRSRYKQGPGYSAQVGRDGFL
FT                   LMTAVYSADAPTGLGNLKAVELLRRCWLEQFMVEGDEVKMRKGGNMPPSAARLESPYDA
FT                   EAHYGVNGGLSWVGYKVHYTESCDEDAPHLVVHVDTTEAAMADLVRVTPIHEQLKQRQL
FT                   LPAEHFVDNQYVTSKLLVDSKKHYSVELVGPIKPHYEAKGFGIGEFKIDWEHKVVTCPG
FT                   GEQSTRWRPEVPKSGRAQITVRFAPSDCRACSLNDRCAKNTTRVGRTLALLPREQYEAR
FT                   EAVKQKQHTQEWLARYQIRTGSEGTFSQAVSAGLRQSRYYGLNKNHLQNVAIAAGMNFQ
FT                   RLSDWFEEIPRAQTRTSRFAALRA"
     atgttgaaac cacagccggt accgcctgtc cccgaaatga ccgcccgagc tgcccacgcc        60
     gcctttccca agggtcattg ttacctcacc ctccgcgatg agctgggaac gatcttcacg       120
     gatgacatgt ttgccgacct ctttcccacc gttggacggc cagcggaagc gccgtggcgg       180
     ctagctttgg tgaccatcgt acagttcgcc gaaggcttgt ccgaccgaga tgtggccgat       240
     gcggtgcgag accgcatcac cctaaagtat ctgttgggac tcgagtacga cgactccggt       300
     ttcgactact ctatcttgtc gcgctttcgt gaccgactgg tcgagggcaa ttcggtagcc       360
     atccttcttg acgccctagt cgaagccagc cgcaaggcgg ggctcatcaa acaccgcggc       420
     aaagtgagaa ccgatgcgac ccatattctt gcgaagattc gtgaactcag tcgcctcgag       480
     ctggtcggcg aaacgcttcg gcacgccttg aacgagatcg ccaaggccgc gccggagtgg       540
     ttgagggcac tggcaccaga tgactggtac aaaaggtatg caaaacgctt tgaagaggag       600
     tcttaccgga gccgatataa gcaaggacca ggctacagtg cccaggtcgg tagagacggc       660
     tttctcttga tgaccgcggt ctatagtgcc gatgctccta ctgggctagg gaacctgaag       720
     gcggttgaac tgttacgtcg ctgctggctc gagcagttca tggtcgaggg tgatgaggtc       780
     aagatgcgta agggcggaaa catgcctcca agtgctgcac ggctcgagtc tccttacgac       840
     gccgaagcgc attacggcgt taacggtggg ctgtcctggg tggggtacaa ggtgcattac       900
     accgaatcgt gtgatgaaga cgcaccccat cttgtcgttc acgtcgatac gactgaagca       960
     gcaatggctg acctcgtgcg cgtcacacct atccacgagc agctcaagca aaggcaacta      1020
     cttcctgctg agcattttgt ggacaatcag tatgtaacct cgaaacttct ggttgacagc      1080
     aagaaacact acagcgtgga actggtgggt cctatcaaac cccactacga agctaagggc      1140
     tttggcatcg gggagttcaa aatcgactgg gagcacaaag tcgttacctg ccctgggggc      1200
     gagcagagta cgcggtggcg acccgaggta cccaaatcgg gtcgagcgca aattacggtg      1260
     cgttttgccc cttccgactg tcgggcgtgc tccctgaacg accgctgtgc caagaacacg      1320
     acgcgtgtgg gccgtactct ggcgctccta ccccgtgagc agtacgaggc gcgtgaagcg      1380
     gttaaacaaa aacagcacac tcaagaatgg ctcgcgcgtt accagatccg tacaggcagt      1440
     gaaggaacgt tctcacaggc ggttagtgcg ggccttcgcc agagtcggta ttatggcttg      1500
     aacaaaaacc accttcagaa cgttgccata gccgctggga tgaacttcca acgcctctcg      1560
     gactggttcg aggagatacc ccgagctcag acgcgaacat cgaggtttgc agcgctaaga      1620
     gcatag                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page