(data stored in ACNUC30630 zone)

EMBL: CP002049.PE440

CP002049.PE440       Location/Qualifiers
FT   CDS_pept        complement(491048..491602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SH3, pleckstrin-like and PDZ/DHR/GLGF
FT                   domain-containing protein; SPTR: A9UNP0 SH3,
FT                   pleckstrin-like and PDZ/DHR/GLGF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13583"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS51"
FT                   /protein_id="ADI13583.1"
FT                   /translation="MNLPNIPFELLLIALFFLLPALGNLLGKRPPPRPPAGGRPREGTN
FT                   PDAAPAARPPGDDALQRRLEEARRRVQEAAAQERSRRGGRAPAPPPSAPPRAPVPQPPS
FT                   APPRRPSDERPATPPSPPLEVAPAMRVQRLEAPKRVTITSRAGRGPFTDPTATLQGFIW
FT                   HQVLSPPRAKRPATLSRRRRR"
     gtgaacctgc ccaacatccc cttcgagctc ctcctgatcg cgctgttttt cctcctcccc        60
     gcgctcggca acctcctcgg caaacgcccc ccgccccgcc ctccagcggg ggggcgtccc       120
     cgcgagggca ccaaccccga cgccgccccc gcagcgcgcc ctccgggcga cgacgccctg       180
     cagcgccgct tagaggaggc gcgccggcgc gtgcaggagg cggcggcgca ggagcgctcc       240
     aggcgcggcg gacgcgcacc ggcgccgccg cccagcgcgc ccccgcgcgc gcccgtccct       300
     cagcccccct cggcaccccc caggcgcccg agcgacgaac gtcctgcgac gccccccagc       360
     ccgccgctcg aggtcgcacc cgctatgcgt gtacaacgcc tggaggcccc gaaacgcgtt       420
     acaatcacct cgagagcggg gcgcgggccc tttaccgacc cgacggcgac cctacagggg       480
     tttatctggc accaggtgct ctcaccgccg cgcgccaagc gacccgctac gctctctagg       540
     aggagacgcc gatag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page