(data stored in ACNUC30630 zone)

EMBL: CP002049.PE448

CP002049.PE448       Location/Qualifiers
FT   CDS_pept        498385..499806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0454"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR016066:IPR005841:IPR005844:IPR005845:IPR
FT                   005846:IPR005843:IPR016055; KEGG: dra:DR_A0047
FT                   phospho-sugar mutase, putative; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; PRIAM:
FT                   Phosphoglucosamine mutase; SPTR: C1XTB1 Phosphomannomutase;
FT                   PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13591"
FT                   /db_xref="GOA:D7CS59"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS59"
FT                   /protein_id="ADI13591.1"
FT                   /translation="MDTLVFGTDGWRDVIGDKFTFLNVARAAQAYADFLNAQGTPSAVV
FT                   GYDTRFNGALFARRVAEVLAANGIDTRLSASYLPTPALSFAVKHYGVGGGVMLTASHNP
FT                   PPYSGFKLKGPYGGTATEDIYRAVAARVATVSEREVRRDGGAKRIETFDVRAAYYDALA
FT                   QLVDLEALRRFDGTLVHDAMGGAAAGWLTGFVAHAELPWRLVALRGEPTPTFYGVNPEP
FT                   LPQNLAATMAYMKEQGALFASATDGDGDRLGLVLPGGTFFNSHQIFALLLNMLAERGGT
FT                   GRVVKTFTVSRLIERLAEKRGLAVQETPVGFKYIVDAMLGGDVLIGGEESGGIGVAGHI
FT                   PERDGLANTLLVLEAVVKAGRTVSELFAELEREAGWRHAYDRLDLHLSGNALKDAVLGA
FT                   LASPPDTFAGRALERVETLDGVKLNLSGNAWLLFRASGTEPVLRIYCEAPSAGEVAEIL
FT                   SSAQRFVSGLEAPGS"
     atggacaccc tcgttttcgg caccgacggt tggcgcgacg tgatcggcga caagttcacc        60
     ttcctcaacg tggcgcgggc ggcgcaggcg tacgcggact ttctcaacgc ccagggtacg       120
     ccgagcgccg tggtcggtta cgacacccgc tttaacggcg ccctcttcgc gcggcgcgtg       180
     gcggaggtgc tcgcggccaa cggcatcgac acccgcctct cggcgagcta cctgccgacc       240
     cccgcgctct cgttcgccgt caagcactac ggggtcggcg gcggggtgat gctcaccgcc       300
     tcgcacaacc cgccccccta tagcggcttt aagcttaaag gtccttacgg cggcaccgcc       360
     acggaggaca tctatagggc ggtcgccgcg cgcgtcgcta cggtgagcga acgtgaggtt       420
     cgccgcgacg ggggggcgaa gcgcatcgag accttcgacg tgcgcgccgc ctactacgac       480
     gcgttggcgc agctcgtcga cctcgaggcg ctgcggcgct ttgacggcac cttggtgcac       540
     gacgcgatgg gtggcgcggc ggcggggtgg ctcacggggt ttgtcgccca cgccgagctg       600
     ccgtggcgtt tggtggcgct gcgcggcgaa ccgacgccga ccttttacgg cgtcaatccg       660
     gagccgctgc cgcaaaacct cgccgccacg atggcctaca tgaaagagca aggcgccctt       720
     ttcgcctccg ccaccgacgg cgacggtgac cgcctcggtt tggtgctgcc gggggggacg       780
     tttttcaact cgcaccagat cttcgcgctg ctcttaaaca tgctcgccga gcggggcgga       840
     acggggcgcg tggtcaagac ctttaccgtc tcgcgcctta tcgagcggct ggccgaaaag       900
     cgcggcctag cggtgcagga gacgccggtg ggctttaagt acatcgtcga cgccatgctg       960
     gggggggacg tgctgatcgg cggcgaggag tcgggcggca tcggcgtcgc ggggcacatc      1020
     cccgagcgcg acgggctggc caacacgctg ctcgtgctag aggcggtggt caaagcgggg      1080
     cggacggtga gcgaactctt tgccgagctc gagcgggagg ccgggtggcg ccacgcctac      1140
     gaccggctcg acctgcacct ttcgggcaac gccctcaaag acgccgtttt gggtgcgctg      1200
     gcctccccgc ccgacacctt tgccgggcgc gcgttggagc gcgtcgaaac cctcgacggg      1260
     gtcaagctca acctctccgg caacgcctgg ctgctctttc gcgcctccgg taccgagccg      1320
     gtcctgcgca tctactgcga agcgccgagc gcgggcgaag tcgcagagat cctgagctcg      1380
     gcgcagcgct tcgtgagcgg cttggaggcc ccgggaagct ag                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page